SAXSdb — 5wyl

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Putative uncharacterized protein

Chaetomium thermophilum var. thermophilum DSM 1495

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	Putative uncharacterized protein × 1 （G0SCS8） water × 2	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 2	Putative uncharacterized protein × 1 （G0SCS8） water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	G0S5L1_CHATD
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–471； UniProt 1–471 Author chain C； PDBConstruct 1–471； UniProt 1–471

Putative uncharacterized protein

Chaetomium thermophilum var. thermophilum DSM 1495

UniProt G0SCS8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	Putative uncharacterized protein × 1 （G0S5L1） water × 2	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 2	Putative uncharacterized protein × 1 （G0S5L1） water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	G0SCS8_CHATD
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–54； UniProt 907–960 Author chain D； PDBConstruct 1–54； UniProt 907–960

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	5wyl
Deposition date deposition_date	2017-01-13
Structure title title	Crystal structure of Chaetomium thermophilum Utp10 N-terminal domain in complex with Utp17 C-terminal helices
Keywords keywords	nucleolar protein, protein complex, components of 90S preribosome, RIBOSOMAL PROTEIN-NUCLEAR PROTEIN complex; RIBOSOMAL PROTEIN/NUCLEAR PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

5wyl__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

5wyl__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

5wyl__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	29.15 Å
Rg (electron density)	28.91 Å
Total Rg	29.23 Å
Atom count	3478
Residues	450
Excluded volume	62803 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`5wyl__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`5wyl__assembly_2__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Putative uncharacterized protein
Molecular weight formula_weight	52228.4 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,C
Atom count atom_count	7086

MASSLAQQLAQIAANSRSSFNVKALKASHSKSLIWEPRVAVSQTFAEIYSQCYEGFKELCHLDSRFVPFDATLFSAQSQEVDRTQMTAEENAALDKRVDSFLHLVGSRLRLMPAIKAVEWLIRRFRIHEFNTGTLLATFLPYHTIPAFVTLLSILPVQRIPIEYRFLDPYIKSLTPPPRAAIVQQATNRPDLLSAISRYTLDSCRAKQEYPGLISFWGGIMAEAVNGMIDKMRSGRRAIQLENDHLLLQQIGPVLSEAMVMKDVPGIQIASYMVVAILAAKGSLNDNILTAFMEQLVHGWTVDTLRPGLVCLTMLAQHRSAKQLSGRVAKAVIKVPDLVSSLRDISKEHQVDKLANGLVLAFVDRLAKKGDIRTLPVINSLLLSELLQEKQAKVAYKALLLAAHKIDDNVDADGNIRKQVGSALVRLSQAEGDVGDAIRTAIQEVDFNIEELELKLGAAIRPKLAIEEAPE

Source Source

Source organism organism	Chaetomium thermophilum var. thermophilum DSM 1495
NCBI taxonomy ID ncbi_taxonomy_id	759272
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Putative uncharacterized protein
Molecular weight formula_weight	5922.6 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,D

DLDMEDNEDTHAVVVAPQRLAEIFNAAPAFAMPPIEDVFYQVASLFSTKPVINA

Source Source

Source organism organism	Chaetomium thermophilum var. thermophilum DSM 1495
NCBI taxonomy ID ncbi_taxonomy_id	759272
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	55

▶

Unit-cell length a length_a	98.309 Å
Unit-cell length b length_b	98.309 Å
Unit-cell length c length_c	235.653 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	16

Space group space_group	P 41 21 2
Space-group number int_tables_number	92
Crystal system crystal_system	—

Resolution resolution	2.638 Å
Low-resolution limit resolution_low	39.010 Å
R factor r_factor	0.2150
R_work r_work	0.2118
R_free r_free	0.2667

Crystal structure of Chaetomium thermophilum Utp10 N-terminal domain in complex with Utp17 C-terminal helices

1. Protein Identity and Related Structures Protein Identity & Related Structures

Putative uncharacterized protein

State in the Current Structure

Other States of the Same Protein in the Database

Putative uncharacterized protein

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

5wyl__assembly_1__model_1

5wyl__assembly_1__model_1 | I(q)

5wyl__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 water

7. Citations (1)

Crystal structure of Chaetomium thermophilum Utp10 N-terminal domain in complex with Utp17 C-terminal helices

1. Protein Identity and Related Structures Protein Identity & Related Structures

Putative uncharacterized protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Putative uncharacterized protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

5wyl__assembly_1__model_1

5wyl__assembly_1__model_1 | I(q)

5wyl__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 water

7. Citations (1)