SAXSdb — 5x33

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

LTB4 receptor,Lysozyme,LTB4 receptor

Cavia porcellus

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Monomer	Protein 1	4-[[3-[[4-[2-(4-hydroxyphenyl)propan-2-yl]phenoxy]methyl]phenyl]methoxy]benzenecarboximidamide × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A097J792_BPT4
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 217–376； UniProt 2–161

LTB4 receptor,Lysozyme,LTB4 receptor

Cavia porcellus

UniProt Q9WTK1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Monomer	Protein 1	4-[[3-[[4-[2-(4-hydroxyphenyl)propan-2-yl]phenoxy]methyl]phenyl]methoxy]benzenecarboximidamide × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q9WTK1_CAVPO
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 14–212； UniProt 15–213 Author chain A； PDBConstruct 381–515； UniProt 214–348

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	5x33
Deposition date deposition_date	2017-02-03
Structure title title	Leukotriene B4 receptor BLT1 in complex with BIIL260
Keywords keywords	helix, MEMBRANE PROTEIN; MEMBRANE PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

5x33__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

5x33__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

5x33__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	29.76 Å
Rg (electron density)	29.17 Å
Total Rg	29.72 Å
Atom count	3375
Residues	439
Excluded volume	61006 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`5x33__assembly_1__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Description description	LTB4 receptor,Lysozyme,LTB4 receptor
Molecular weight formula_weight	57755.1 kDa
EC 编号 ec_number	3.2.1.17
Mutation mutation	H83G,K88G,V212A,C1054T,C1097A,S102A
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	3375

ELMDYKDDDDKEFSNTFIPLLAMILLSVSMVVGLPGNTFVVWSILKRMRKRSVTALMVLNLALADLAVLLTAPFFLHFLTWGTWSFGLAGCRLCHYICGVSMYASVLLITAMSLDRSLAVASPFLSQKVRTKTAARWLLVGIWGASFLLATPVLAFRKVVKLTNETDLCLAVYPSDRHKAFHLLFEAFTGFVVPFLIVVASYADISRRLRARGSGSNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYGSGSRFHRRRRTGRLVVIIILAFAAFWLPYHVVDLVEGSRVLAGTLDQSKQQLRNARKVCIALAFLSSSVNPLLYACAGGGLLRSAGVGFVAKLLEATGAEAFSTRRGGTLAQTVKGIPMAPEPGASGSLDGLKQSESDEFLEVLFQ

Source Source

Source organism organism	Cavia porcellus
Common name common_name	Guinea pig
NCBI taxonomy ID ncbi_taxonomy_id	10141
Host organism host_organism	Komagataella pastoris CBS 7435

Entity 2 Entity 2 non-polymer

Description description	4-[[3-[[4-[2-(4-hydroxyphenyl)propan-2-yl]phenoxy]methyl]phenyl]methoxy]benzenecarboximidamide
Molecular weight formula_weight	466.6 kDa
Source method src_method	syn
Copy count entity_count	1

▼

6. Fold Classification (SCOP + CATH) 1 domains

CATH v4.4 (1 domains)

Domain ID domain_id	5x33A01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	530 — Lysozyme
Homologous superfamily homologous superfamily	40 —

▶

Unit-cell length a length_a	69.560 Å
Unit-cell length b length_b	77.620 Å
Unit-cell length c length_c	135.530 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	4

Space group space_group	P 2 21 21
Space-group number int_tables_number	18
Crystal system crystal_system	—

Resolution resolution	3.700 Å
Low-resolution limit resolution_low	48.539 Å
R factor r_factor	0.2508
R_work r_work	0.2484
R_free r_free	0.2958

Leukotriene B4 receptor BLT1 in complex with BIIL260

1. Protein Identity and Related Structures Protein Identity & Related Structures

LTB4 receptor,Lysozyme,LTB4 receptor

State in the Current Structure

Other States of the Same Protein in the Database

LTB4 receptor,Lysozyme,LTB4 receptor

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

5x33__assembly_1__model_1

5x33__assembly_1__model_1 | I(q)

5x33__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

6. Fold Classification (SCOP + CATH) 1 domains

CATH v4.4 (1 domains)

7. Citations (1)

Leukotriene B4 receptor BLT1 in complex with BIIL260

1. Protein Identity and Related Structures Protein Identity & Related Structures

LTB4 receptor,Lysozyme,LTB4 receptor

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

LTB4 receptor,Lysozyme,LTB4 receptor

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

5x33__assembly_1__model_1

5x33__assembly_1__model_1 | I(q)

5x33__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

6. Fold Classification (SCOP + CATH) 1 domains

CATH v4.4 (1 domains)

7. Citations (1)