SAXSdb — 5zwl

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

ATP synthase epsilon chain

Thermosynechococcus elongatus (strain BP-1)

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	ATP synthase gamma chain × 1 （Q8DLU1） water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ATPE_THEEB
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain E； PDBConstruct 1–138； UniProt 1–138

ATP synthase gamma chain

Thermosynechococcus elongatus (strain BP-1)

UniProt Q8DLU1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	ATP synthase epsilon chain × 1 （Q8DLG7） water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ATPG_THEEB
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain G； PDBConstruct 3–276； UniProt 12–285

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	5zwl
Deposition date deposition_date	2018-05-16
Structure title title	Crystal structure of the gamma - epsilon complex of photosynthetic cyanobacterial F1-ATPase
Keywords keywords	ATP synthase gamma epsilon cyanobacteria redox regulation, HYDROLASE; HYDROLASE
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

5zwl__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

5zwl__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

5zwl__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	23.26 Å
Rg (electron density)	21.98 Å
Total Rg	22.95 Å
Atom count	3012
Residues	392
Excluded volume	53965 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`5zwl__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	ATP synthase epsilon chain
Molecular weight formula_weight	14764.8 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E
Atom count atom_count	3196

MVMTVRVIAPDKTVWDAPAEEVILPSTTGQLGILSNHAPLLTALETGVMRVRQDREWVAIALMGGFAEVENNEVTILVNGAERGDTIDLEKAKAEFAAAQAALAQAEQGESKQAKIQATQAFRRARARLQAAGGVVEI

Source Source

Source organism organism	Thermosynechococcus elongatus (strain BP-1)
NCBI taxonomy ID ncbi_taxonomy_id	197221
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 2 Entity 2 polymer

Description description	ATP synthase gamma chain
Molecular weight formula_weight	31100.9 kDa
Mutation mutation	R33A,R34A
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

MEKTIKDTRKITEAMRLVAAAKVAAAQEQVMASRPFADRLAQVLYSLQTRLRFEDVDLPLLAKRPVKTVALLVVTGDRGLCGGYNTNVIRRAKERLQELEAEGLKYTLVIVGRKAAQYFQRRDYPIDAVYSGLEQIPSASEAGQIASELLSLFLSETVDRVELIYTKFVSLISSKPVVQTLLPLDPQGLETADDEIFRLTTRGSHLEVNREKVTSTLPALPSDMIFEQDPLQILDALLPLYLNNQLLRALQEAAASELAARMTAMNNASDNAQALILVPR

Source Source

Source organism organism	Thermosynechococcus elongatus (strain BP-1)
NCBI taxonomy ID ncbi_taxonomy_id	197221
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	178

▼

6. Fold Classification (SCOP + CATH) 2 domains

CATH v4.4 (2 domains)

Domain ID domain_id	5zwlE01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	15 — ATP Synthase; domain 1
Homologous superfamily homologous superfamily	10 — F0F1 ATP synthase delta/epsilon subunit, N-terminal

Domain ID domain_id	5zwlE02
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	540 — Helix hairpin bin

▶

Unit-cell length a length_a	71.556 Å
Unit-cell length b length_b	71.556 Å
Unit-cell length c length_c	204.969 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	P 41 21 2
Space-group number int_tables_number	92
Crystal system crystal_system	—

Resolution resolution	1.980 Å
Low-resolution limit resolution_low	36.004 Å
R factor r_factor	0.2069
R_work r_work	0.2051
R_free r_free	0.2420

Crystal structure of the gamma - epsilon complex of photosynthetic cyanobacterial F1-ATPase

1. Protein Identity and Related Structures Protein Identity & Related Structures

ATP synthase epsilon chain

State in the Current Structure

Other States of the Same Protein in the Database

ATP synthase gamma chain

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

5zwl__assembly_1__model_1

5zwl__assembly_1__model_1 | I(q)

5zwl__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 2 domains

CATH v4.4 (2 domains)

7. Citations (1)

Crystal structure of the gamma - epsilon complex of photosynthetic cyanobacterial F1-ATPase

1. Protein Identity and Related Structures Protein Identity & Related Structures

ATP synthase epsilon chain

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

ATP synthase gamma chain

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

5zwl__assembly_1__model_1

5zwl__assembly_1__model_1 | I(q)

5zwl__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 2 domains

CATH v4.4 (2 domains)

7. Citations (1)