SAXSdb — 6at6

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

T-cell receptor beta variable 28, Human nkt tcr beta chain chimera

Homo sapiens

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Insufficient information Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain B； UniProt 20–113	Not recorded	T-cell receptor alpha variable 4, T-cell receptor, sp3.4 alpha chain chimera × 1 （A0A0B4J268,K7N5N2）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 8.5；277 K；0.1 M Tris-HCl pH 8.5 and 25 % PEG3350	Resolution 1.42 Å R-free 0.218

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 6AT6	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6AVF Crystal structure of the KFJ5 TCR-NY-ESO-1-HLA-B*07:02 complex Deposited 2017-09-02	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain B 20–114（95 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；293 K；0.1 M MIB pH 7.0 and 25 % (w/v) PEG 1500	Resolution 2.03 Å R-free 0.256

1 other PDB entries and 1 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	A0A5B6_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain B； PDBConstruct 3–96； UniProt 20–113

T-cell receptor beta variable 28, Human nkt tcr beta chain chimera

Homo sapiens

UniProt K7N5M4

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Insufficient information Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain B； UniProt 120–249	Not recorded	T-cell receptor alpha variable 4, T-cell receptor, sp3.4 alpha chain chimera × 1 （A0A0B4J268,K7N5N2）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 8.5；277 K；0.1 M Tris-HCl pH 8.5 and 25 % PEG3350	Resolution 1.42 Å R-free 0.218

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 6AT6	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
3PQY Crystal Structure of 6218 TCR in complex with the H2Db-PA224 Deposited 2010-11-28	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 5 PDB declaration: pentameric	Chain E 107–249（143 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.8；277 K；10-14% PEG 3350, 0.2M KCN, 0.1M Bis Tris Propane pH 6.8, 5% glycerol, vapor diffusion, hanging drop, temperature 277K	Resolution 3.19 Å R-free 0.316
3PQY Crystal Structure of 6218 TCR in complex with the H2Db-PA224 Deposited 2010-11-28	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Heteromer；Protein × 5 PDB declaration: pentameric	Chain J 107–249（143 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.8；277 K；10-14% PEG 3350, 0.2M KCN, 0.1M Bis Tris Propane pH 6.8, 5% glycerol, vapor diffusion, hanging drop, temperature 277K	Resolution 3.19 Å R-free 0.316
3PQY Crystal Structure of 6218 TCR in complex with the H2Db-PA224 Deposited 2010-11-28	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 3 Insufficient information Heteromer；Protein × 5 PDB declaration: pentameric	Chain O 107–249（143 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.8；277 K；10-14% PEG 3350, 0.2M KCN, 0.1M Bis Tris Propane pH 6.8, 5% glycerol, vapor diffusion, hanging drop, temperature 277K	Resolution 3.19 Å R-free 0.316
3PQY Crystal Structure of 6218 TCR in complex with the H2Db-PA224 Deposited 2010-11-28	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 4 Insufficient information Heteromer；Protein × 5 PDB declaration: pentameric	Chain T 107–249（143 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.8；277 K；10-14% PEG 3350, 0.2M KCN, 0.1M Bis Tris Propane pH 6.8, 5% glycerol, vapor diffusion, hanging drop, temperature 277K	Resolution 3.19 Å R-free 0.316
4MNH Structure of the DP10.7 TCR Deposited 2013-09-10	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 120–259（140 aa） Fragment：DP10.7 TCR gamma variable domain fused with human TCR beta constant domain	Mutation：S173C, C191A	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；292 K；0.1 M Tris pH 8.5, 20% PEG 10k, VAPOR DIFFUSION, SITTING DROP, temperature 292K	Resolution 3.30 Å R-free 0.285
4MNH Structure of the DP10.7 TCR Deposited 2013-09-10	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 120–259（140 aa） Fragment：DP10.7 TCR gamma variable domain fused with human TCR beta constant domain	Mutation：S173C, C191A	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；292 K；0.1 M Tris pH 8.5, 20% PEG 10k, VAPOR DIFFUSION, SITTING DROP, temperature 292K	Resolution 3.30 Å R-free 0.285
5BRZ MAGE-A3 reactive TCR in complex with MAGE-A3 in HLA-A1 Deposited 2015-06-01	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 5 PDB declaration: pentameric	Chain E 108–248（141 aa）	Not recorded	SO4 SULFATE ION × 7	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；291 K；0.2M ammonium chloride, 0.1M HEPES pH7, 15% PEG 8000	Resolution 2.62 Å R-free 0.268
5BS0 MAGE-A3 Reactive TCR in complex with Titin Epitope in HLA-A1 Deposited 2015-06-01	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 5 PDB declaration: pentameric	Chain E 108–249（142 aa）	Not recorded	GOL GLYCEROL × 1 SO4 SULFATE ION × 11	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；291 K；0.2M Ammonium Chloride, 0.1M MES, 20% PEG 4000	Resolution 2.40 Å R-free 0.262
5MEN Human Leukocyte Antigen A02 presenting ILAKFLHWL, in complex with cognate T-Cell Receptor Deposited 2016-11-16	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 5 PDB declaration: pentameric	Chain E 125–249（125 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 5 GOL GLYCEROL × 1 SO4 SULFATE ION × 5	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；0.2M ammonium sulphate, 0.1M HEPES pH7, 20% PEG 8000	Resolution 2.81 Å R-free 0.272
5WLG Crystal Structure of H-2Db with the GAP501 peptide (SQL) Deposited 2017-07-26	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 5 PDB declaration: pentameric	Chain E 120–249（130 aa）	Not recorded	NA SODIUM ION × 1 CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 7.2；277 K；18%PEG3350, 2% ethylen glycol, 0.2M CaCl2, 0.1M HEPES pH 7.2	Resolution 2.10 Å R-free 0.249
5WLG Crystal Structure of H-2Db with the GAP501 peptide (SQL) Deposited 2017-07-26	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Heteromer；Protein × 5 PDB declaration: pentameric	Chain J 120–249（130 aa）	Not recorded	NA SODIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 7.2；277 K；18%PEG3350, 2% ethylen glycol, 0.2M CaCl2, 0.1M HEPES pH 7.2	Resolution 2.10 Å R-free 0.249
6BJ2 TCR589 in complex with HIV(Pol448-456)/HLA-B35 Deposited 2017-11-03	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 5 PDB declaration: pentameric	Chain E 120–249（130 aa）	Not recorded	ZN ZINC ION × 3 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 8；295 K；0.1 M Tris, pH 8.0, 20% PEG3350, 0.002 M zinc chloride	Resolution 3.35 Å R-free 0.276
6BJ3 TCR55 in complex with HIV(Pol448-456)/HLA-B35 Deposited 2017-11-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain H 107–249（143 aa）	Mutation：A187C	EDO 1,2-ETHANEDIOL × 3 SO4 SULFATE ION × 5	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；295 K；PEG4000, 0.1 M sodium cacodylate, pH 6.0, 0.2 M ammonium sulfate	Resolution 1.90 Å R-free 0.216
6BJ8 TCR55 in complex with Pep20/HLA-B35 Deposited 2017-11-05	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain H 107–249（143 aa）	Mutation：A187C	GOL GLYCEROL × 27 PO4 PHOSPHATE ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；295 K；0.04 M potassium phosphate monobasic, 16% w/v PEG8000, 20% v/v glycerol	Resolution 1.75 Å R-free 0.183
6CW6 Structure of alpha-GC[8,18] bound by CD1d and in complex with the Va14Vb8.2 TCR Deposited 2018-03-29	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 4 PDB declaration: tetrameric	Chain D 138–248（111 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2 PBS (2S,3S,4R)-N-OCTANOYL-1-[(ALPHA-D-GALACTOPYRANOSYL)OXY]-2-AMINO-OCTADECANE-3,4-DIOL × 1 PLM PALMITIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4；295 K；8% Tacsimate pH 4.0 20% PEG 3350	Resolution 2.85 Å R-free 0.250
6D78 The complex between high-affinity TCR DMF5(alpha-D26Y,beta-L98W) and human Class I MHC HLA-A2 with the bound MART-1(27-35)peptide Deposited 2018-04-24	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain E 125–249（125 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；298 K；0.1 M Tris, 12% PEG6000, 0.2 M magnesium chloride	Resolution 2.35 Å R-free 0.255
6DKP The complex among DMF5(alpha-D26Y, alpha-Y50A,beta-L98W) TCR, human Class I MHC HLA-A2 and MART-1(26-35)(A27L) peptide Deposited 2018-05-30	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 5 PDB declaration: pentameric	Chain E 120–249（130 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；298 K；12% Peg 3350, 250mM MgCl2, 0.1M HEPES	Resolution 2.97 Å R-free 0.286
6PY2 HLA-TCR complex Deposited 2019-07-28	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain E 120–249（130 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3 GOL GLYCEROL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；0.1 M MES, pH 6.5, 5% v/v MPD, 15% w/v PEG6000	Resolution 2.83 Å R-free 0.244
6Q3S Engineered Human HLA_A2 MHC Class I molecule in complex with TCR and SV9 peptide Deposited 2018-12-04	Different construct Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Heteromer；Protein × 2 PDB declaration: dimeric	Chain E 123–249（127 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；0.1 M ammonium acetate; 0.1 M bis-tris pH 5.5, 17 %(w/v) PEG 10.000	Resolution 2.50 Å R-free 0.273
6R2L NYBR1-A2-SLSKILDTV Deposited 2019-03-18	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 5 PDB declaration: pentameric	Chain E 107–249（143 aa）	Not recorded	PEG DI(HYDROXYETHYL)ETHER × 1 EDO 1,2-ETHANEDIOL × 2 GOL GLYCEROL × 3 SO4 SULFATE ION × 8 EPE 4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6；291 K；0.2 M NaCl, 0.1 M MES, 20% PEG 6000, pH 6.0 . Condition B07 from Molecular Dimensions PACT premier HT-96/FX-96, MD1-36	Resolution 2.30 Å R-free 0.265
6U07 Computational Stabilization of T Cell Receptor Constant Domains Deposited 2019-08-13	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 120–249（130 aa）	Not recorded	MG MAGNESIUM ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；293 K；23% PEG 4K, 300 mM magnesium sulfate, 10% glycerol	Resolution 1.76 Å R-free 0.226
6V80 Crystal structure of human CD1d presenting alpha-Galactosylceramide in complex with NKT12 TCR and VHH nanobody 1D12 Deposited 2019-12-10	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 5 PDB declaration: pentameric	Chain D 6–249（244 aa）	Not recorded	AGH N-{(1S,2R,3S)-1-[(ALPHA-D-GALACTOPYRANOSYLOXY)METHYL]-2,3-DIHYDROXYHEPTADECYL}HEXACOSANAMIDE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；21 % (v/v) PEG 3350, 0.2 M tri-sodium citrate, 3% (v/v) D-(+)-trehalose dehydrate	Resolution 3.53 Å R-free 0.254
6V80 Crystal structure of human CD1d presenting alpha-Galactosylceramide in complex with NKT12 TCR and VHH nanobody 1D12 Deposited 2019-12-10	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Heteromer；Protein × 5 PDB declaration: pentameric	Chain I 6–249（244 aa）	Not recorded	AGH N-{(1S,2R,3S)-1-[(ALPHA-D-GALACTOPYRANOSYLOXY)METHYL]-2,3-DIHYDROXYHEPTADECYL}HEXACOSANAMIDE × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；21 % (v/v) PEG 3350, 0.2 M tri-sodium citrate, 3% (v/v) D-(+)-trehalose dehydrate	Resolution 3.53 Å R-free 0.254
7M72 MHC-like protein complex structure Deposited 2021-03-26	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 4 PDB declaration: tetrameric	Chain D 120–249（130 aa） Fragment：murine variable domain,human constant domain	Not recorded	QOD (3R)-N-[(2S,3R)-1-(alpha-D-galactopyranosyloxy)-3-hydroxy-15-methylhexadecan-2-yl]-3-hydroxyheptadecanamide × 1 HP6 HEPTANE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5；277 K；18-20% PEG 3350, 8% Tacsimate pH 5.0	Resolution 2.40 Å R-free 0.227
7N4K 6218 TCR in complex with H2-Db PA 224 Deposited 2021-06-04	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 5 PDB declaration: pentameric	Chain E 107–249（143 aa）	Not recorded	NA SODIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；293 K；20% PEG3350, 0.2 M NaF, 0.05 M NaForm, 1% 1,5-Diaminopentane dihydrochloride	Resolution 1.85 Å R-free 0.214
7N5C 6218 TCR in complex with H2Db PA with an engineered TCR-pMHC disulfide bond Deposited 2021-06-05	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 5 PDB declaration: pentameric	Chain E 107–249（143 aa）	Not recorded	NA SODIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；293 K；20% PEG3350, 0.2M NaF, 0.05M NaForm, 1% 1,5-Diaminopentane dihydrochloride	Resolution 1.87 Å R-free 0.233
7N5P 6218 TCR in complex with H2-Db PA224-233 with a cysteine mutant Deposited 2021-06-06	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 5 PDB declaration: pentameric	Chain E 107–249（143 aa）	Not recorded	NA SODIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；293 K；20% PEG3350, 0.2M NaF, 0.05M NaForm, 1% 1,5-Diaminopentane dihydrochloride	Resolution 2.09 Å R-free 0.236
7NDQ Gag:02 TCR in complex with HLA-E. Deposited 2021-02-02	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 5 PDB declaration: pentameric	Chain EEE 120–249（130 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；23.2% (w/v) PEG 1500, 93 mM MMT pH 9.0	Resolution 2.55 Å R-free 0.296
7NDU Gag:02 TCR in complex with HLA-E featuring a non-natural amino acid Deposited 2021-02-02	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 5 PDB declaration: pentameric	Chain EEE 120–249（130 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；22.3% (w/v) PEG 1500, 89 mM MMT pH 9.0	Resolution 2.90 Å R-free 0.301

23 other PDB entries and 29 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	K7N5M4_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain B； PDBConstruct 116–245； UniProt 120–249

T-cell receptor alpha variable 4, T-cell receptor, sp3.4 alpha chain chimera

Homo sapiens

UniProt A0A0B4J268

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Insufficient information Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain A； UniProt 18–108	Not recorded	T-cell receptor beta variable 28, Human nkt tcr beta chain chimera × 1 （A0A5B6,K7N5M4）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 8.5；277 K；0.1 M Tris-HCl pH 8.5 and 25 % PEG3350	Resolution 1.42 Å R-free 0.218

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 6AT6	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6AVF Crystal structure of the KFJ5 TCR-NY-ESO-1-HLA-B*07:02 complex Deposited 2017-09-02	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain A 18–109（92 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；293 K；0.1 M MIB pH 7.0 and 25 % (w/v) PEG 1500	Resolution 2.03 Å R-free 0.256
6AVG Crystal structure of the KFJ37 TCR-NY-ESO-1-HLA-B*07:02 complex Deposited 2017-09-02	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain C 18–109（92 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.8；293 K；0.1 M BTP pH 8.8, 0.2 M Na-Iodide, 14 % w/v PEG 3350 and 2 % w/v PEG 20000	Resolution 2.60 Å R-free 0.248
6AVG Crystal structure of the KFJ37 TCR-NY-ESO-1-HLA-B*07:02 complex Deposited 2017-09-02	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain B 18–109（92 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.8；293 K；0.1 M BTP pH 8.8, 0.2 M Na-Iodide, 14 % w/v PEG 3350 and 2 % w/v PEG 20000	Resolution 2.60 Å R-free 0.248
7NDQ Gag:02 TCR in complex with HLA-E. Deposited 2021-02-02	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 5 PDB declaration: pentameric	Chain DDD 18–108（91 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；23.2% (w/v) PEG 1500, 93 mM MMT pH 9.0	Resolution 2.55 Å R-free 0.296
7NDU Gag:02 TCR in complex with HLA-E featuring a non-natural amino acid Deposited 2021-02-02	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 5 PDB declaration: pentameric	Chain DDD 18–108（91 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；22.3% (w/v) PEG 1500, 89 mM MMT pH 9.0	Resolution 2.90 Å R-free 0.301

4 other PDB entries and 5 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	A0A0B4J268_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain A； PDBConstruct 3–93； UniProt 18–108

T-cell receptor alpha variable 4, T-cell receptor, sp3.4 alpha chain chimera

Homo sapiens

UniProt K7N5N2

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Insufficient information Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain A； UniProt 115–207	Not recorded	T-cell receptor beta variable 28, Human nkt tcr beta chain chimera × 1 （A0A5B6,K7N5M4）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 8.5；277 K；0.1 M Tris-HCl pH 8.5 and 25 % PEG3350	Resolution 1.42 Å R-free 0.218

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 6AT6	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
3PQY Crystal Structure of 6218 TCR in complex with the H2Db-PA224 Deposited 2010-11-28	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 5 PDB declaration: pentameric	Chain D 115–201（87 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.8；277 K；10-14% PEG 3350, 0.2M KCN, 0.1M Bis Tris Propane pH 6.8, 5% glycerol, vapor diffusion, hanging drop, temperature 277K	Resolution 3.19 Å R-free 0.316
3PQY Crystal Structure of 6218 TCR in complex with the H2Db-PA224 Deposited 2010-11-28	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Heteromer；Protein × 5 PDB declaration: pentameric	Chain I 115–201（87 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.8；277 K；10-14% PEG 3350, 0.2M KCN, 0.1M Bis Tris Propane pH 6.8, 5% glycerol, vapor diffusion, hanging drop, temperature 277K	Resolution 3.19 Å R-free 0.316
3PQY Crystal Structure of 6218 TCR in complex with the H2Db-PA224 Deposited 2010-11-28	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 3 Insufficient information Heteromer；Protein × 5 PDB declaration: pentameric	Chain N 115–201（87 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.8；277 K；10-14% PEG 3350, 0.2M KCN, 0.1M Bis Tris Propane pH 6.8, 5% glycerol, vapor diffusion, hanging drop, temperature 277K	Resolution 3.19 Å R-free 0.316
3PQY Crystal Structure of 6218 TCR in complex with the H2Db-PA224 Deposited 2010-11-28	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 4 Insufficient information Heteromer；Protein × 5 PDB declaration: pentameric	Chain S 115–201（87 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.8；277 K；10-14% PEG 3350, 0.2M KCN, 0.1M Bis Tris Propane pH 6.8, 5% glycerol, vapor diffusion, hanging drop, temperature 277K	Resolution 3.19 Å R-free 0.316
5NHT human 199.54-16 TCR in complex with Melan-A/MART-1 (26-35) peptide and HLA-A2 Deposited 2017-03-22	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 5 PDB declaration: pentameric	Chain A 96–205（110 aa）	Mutation：T158C,T158C	SCN THIOCYANATE ION × 1 K POTASSIUM ION × 2 CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；PEG3350 8 %, K Thiocyanate 0.1 M, Bis-Tris propane pH 6.5 0.1 M, protein concentration 3.5 mg/ml	Resolution 3.20 Å R-free 0.299
5WKF D30 TCR in complex with HLA-A*11:01-GTS1 Deposited 2017-07-25	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 5 PDB declaration: pentameric	Chain D 115–203（89 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 7.5；277 K；17%PEG8000, 2% Ethylen glycol, 0.1M HEPES pH7.5	Resolution 2.95 Å R-free 0.253
5WKF D30 TCR in complex with HLA-A*11:01-GTS1 Deposited 2017-07-25	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Heteromer；Protein × 5 PDB declaration: pentameric	Chain I 115–203（89 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 7.5；277 K；17%PEG8000, 2% Ethylen glycol, 0.1M HEPES pH7.5	Resolution 2.95 Å R-free 0.253
5WKH D30 TCR in complex with HLA-A*11:01-GTS3 Deposited 2017-07-25	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 5 PDB declaration: pentameric	Chain D 115–203（89 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 7.5；277 K；17%PEG8000, 2% Ethylen glycol, 0.1M HEPES pH7.5	Resolution 3.20 Å R-free 0.246
5WKH D30 TCR in complex with HLA-A*11:01-GTS3 Deposited 2017-07-25	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Heteromer；Protein × 5 PDB declaration: pentameric	Chain I 115–203（89 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 7.5；277 K；17%PEG8000, 2% Ethylen glycol, 0.1M HEPES pH7.5	Resolution 3.20 Å R-free 0.246
6PY2 HLA-TCR complex Deposited 2019-07-28	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain D 115–207（93 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3 GOL GLYCEROL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；0.1 M MES, pH 6.5, 5% v/v MPD, 15% w/v PEG6000	Resolution 2.83 Å R-free 0.244
6Q3S Engineered Human HLA_A2 MHC Class I molecule in complex with TCR and SV9 peptide Deposited 2018-12-04	Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 115–207（93 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；0.1 M ammonium acetate; 0.1 M bis-tris pH 5.5, 17 %(w/v) PEG 10.000	Resolution 2.50 Å R-free 0.273
7M72 MHC-like protein complex structure Deposited 2021-03-26	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 4 PDB declaration: tetrameric	Chain C 115–207（93 aa） Fragment：murine variable domain,human constant domain	Not recorded	QOD (3R)-N-[(2S,3R)-1-(alpha-D-galactopyranosyloxy)-3-hydroxy-15-methylhexadecan-2-yl]-3-hydroxyheptadecanamide × 1 HP6 HEPTANE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5；277 K；18-20% PEG 3350, 8% Tacsimate pH 5.0	Resolution 2.40 Å R-free 0.227
7N4K 6218 TCR in complex with H2-Db PA 224 Deposited 2021-06-04	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 5 PDB declaration: pentameric	Chain D 115–204（90 aa）	Not recorded	NA SODIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；293 K；20% PEG3350, 0.2 M NaF, 0.05 M NaForm, 1% 1,5-Diaminopentane dihydrochloride	Resolution 1.85 Å R-free 0.214
7N5C 6218 TCR in complex with H2Db PA with an engineered TCR-pMHC disulfide bond Deposited 2021-06-05	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 5 PDB declaration: pentameric	Chain D 115–207（93 aa）	Mutation：S110C	NA SODIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；293 K；20% PEG3350, 0.2M NaF, 0.05M NaForm, 1% 1,5-Diaminopentane dihydrochloride	Resolution 1.87 Å R-free 0.233
7N5P 6218 TCR in complex with H2-Db PA224-233 with a cysteine mutant Deposited 2021-06-06	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 5 PDB declaration: pentameric	Chain D 115–207（93 aa）	Not recorded	NA SODIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；293 K；20% PEG3350, 0.2M NaF, 0.05M NaForm, 1% 1,5-Diaminopentane dihydrochloride	Resolution 2.09 Å R-free 0.236

10 other PDB entries and 15 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	K7N5N2_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain A； PDBConstruct 116–208； UniProt 115–207

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6at6
Deposition date deposition_date	2017-08-28
Structure title title	Crystal structure of the KFJ5 TCR
Keywords keywords	Immunogolbulin, IMMUNE SYSTEM; IMMUNE SYSTEM
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	25.11 Å
Radius of gyration Rg (electron density) rg_electron	24.04 Å
Forward intensity I(0) i0	41706500.00
Molecular weight molecular_weight	48847.0 kDa
Excluded volume excluded_volume	60642 Å³
Envelope volume envelope_volume	75419 Å³
Hydration-shell volume shell_volume	26153 Å³
Envelope diameter envelope_diameter	77.1 Å
Shell Rg shell_rg	31.14 Å
Envelope Rg envelope_rg	23.83 Å
Shape Rg shape_rg	24.03 Å
Total Rg total_rg	24.91 Å
Total atoms total_atoms	3440
Residues n_residues	430
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	75.9 Å
Rg (real space) rg_real	25.03 Å
Rg uncertainty (real space) rg_real_error	0.43 Å
I(0) (real space) i0_real	4.1710e+07
I(0) uncertainty (real space) i0_real_error	5.9050e+05
Rg (reciprocal space) rg_reciprocal	25.06 Å
I(0) (reciprocal space) i0_reciprocal	41710000.0000
Solution quality estimate total_estimate	0.9168
Solution quality rating solution_quality	EXCELLENT a EXCELLENT solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	30.1 Å
Skewness Skewness skewness	0.171
Kurtosis Kurtosis kurtosis	-0.616
Angular range angular_range	— – 0.3150 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	9117000.0000
Real-space data points n_real_points	64
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.980; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.999; Smooth: 0.977

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	T-cell receptor beta variable 28, Human nkt tcr beta chain chimera
Molecular weight formula_weight	28225.6 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B
Atom count atom_count	4066

HMDVKVTQSSRYLVKRTGEKVFLECVQDMDHENMFWYRQDPGLGLRLIYFSYDVKMKEKGDIPEGYSVSREKKERFSLILESASTNQTSMYLCASSQRQEGDTQYFGPGTRLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	Human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	T-cell receptor alpha variable 4, T-cell receptor, sp3.4 alpha chain chimera
Molecular weight formula_weight	23329.9 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A

HMLAKTTQPISMDSYEGQEVNITCSHNNIATNDYITWYQQFPSQGPRFIIQGYKTKVTNEVASLFIPADRKSSTLSLPRVSLSDTAVYYCLVGEILDNFNKFYFGSGTKLNVKPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPSPESS

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	Human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Escherichia coli

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	618

▼

7. Fold Classification (SCOP + CATH) 7 domains

SCOP 2.08 (4 domains)

Domain ID domain_id	d6at6a1
Class class	b — All beta proteins
Fold Fold fold	b.1 — Immunoglobulin-like beta-sandwich
Superfamily Superfamily superfamily	b.1.1 — Immunoglobulin
Family Family family	b.1.1.0 — automated matches

Domain ID domain_id	d6at6a2
Class class	b — All beta proteins
Fold Fold fold	b.1 — Immunoglobulin-like beta-sandwich
Superfamily Superfamily superfamily	b.1.1 — Immunoglobulin
Family Family family	b.1.1.2 — C1 set domains (antibody constant domain-like)

Domain ID domain_id	d6at6b1
Class class	b — All beta proteins
Fold Fold fold	b.1 — Immunoglobulin-like beta-sandwich
Superfamily Superfamily superfamily	b.1.1 — Immunoglobulin
Family Family family	b.1.1.0 — automated matches

Domain ID domain_id	d6at6b2
Class class	b — All beta proteins
Fold Fold fold	b.1 — Immunoglobulin-like beta-sandwich
Superfamily Superfamily superfamily	b.1.1 — Immunoglobulin
Family Family family	b.1.1.2 — C1 set domains (antibody constant domain-like)

CATH v4.4 (3 domains)

Domain ID domain_id	6at6A01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	6at6B01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	6at6B02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

▶

8. Citations (1)

▶

Unit-cell length a length_a	49.904 Å
Unit-cell length b length_b	73.360 Å
Unit-cell length c length_c	123.042 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	4

Space group space_group	P 21 21 21
Space-group number int_tables_number	19
Crystal system crystal_system	—

Resolution resolution	1.417 Å
Low-resolution limit resolution_low	39.121 Å
R factor r_factor	0.1985
R_work r_work	0.1975
R_free r_free	0.2184

fit	/app/data/saxs_computation/at/6at6/6at6.fit
pddf	/app/data/pr_computation/at/6at6/6at6.pr.out
profile	/app/data/saxs_computation/at/6at6/6at6.dat

Crystal structure of the KFJ5 TCR

1. Protein Identity and Related Structures Protein Identity & Related Structures

T-cell receptor beta variable 28, Human nkt tcr beta chain chimera

State in the Current Structure

Other States of the Same Protein in the Database

T-cell receptor beta variable 28, Human nkt tcr beta chain chimera

State in the Current Structure

Other States of the Same Protein in the Database

T-cell receptor alpha variable 4, T-cell receptor, sp3.4 alpha chain chimera

State in the Current Structure

Other States of the Same Protein in the Database

T-cell receptor alpha variable 4, T-cell receptor, sp3.4 alpha chain chimera

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

6. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

来源 Source

Entity 3 Entity 3 water

7. Fold Classification (SCOP + CATH) 7 domains

SCOP 2.08 (4 domains)

CATH v4.4 (3 domains)

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)