6et5

Reaction centre light harvesting complex 1 from Blc. virids

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Photosynthetic reaction center cytochrome c subunit

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 54	Reaction center protein L chain × 1 （P06009） Reaction center protein M chain × 1 （P06010） Reaction center protein H chain × 1 （P06008） Light-harvesting protein B-1015 alpha chain × 17 （P04123） Light-harvesting protein B-1015 beta chain × 17 （P04124） Light-harvesting protein B-1015 gamma chain × 16 （P04126） HEME C × 4 BACTERIOCHLOROPHYLL B × 38 BACTERIOPHEOPHYTIN B × 2 Ubiquinone-9 × 2 FE (III) ION × 1 SULFATE ION × 7 LAURYL DIMETHYLAMINE-N-OXIDE × 2 MENAQUINONE-9 × 1 15-cis-1,2-dihydroneurosporene × 1 all-trans-1,2-dihydroneurosporene × 17	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CYCR_BLAVI
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain C； PDBConstruct 1–333； UniProt 21–353

Reaction center protein L chain

OrganismNot specified

UniProt P06009

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 54	Photosynthetic reaction center cytochrome c subunit × 1 （P07173） Reaction center protein M chain × 1 （P06010） Reaction center protein H chain × 1 （P06008） Light-harvesting protein B-1015 alpha chain × 17 （P04123） Light-harvesting protein B-1015 beta chain × 17 （P04124） Light-harvesting protein B-1015 gamma chain × 16 （P04126） HEME C × 4 BACTERIOCHLOROPHYLL B × 38 BACTERIOPHEOPHYTIN B × 2 Ubiquinone-9 × 2 FE (III) ION × 1 SULFATE ION × 7 LAURYL DIMETHYLAMINE-N-OXIDE × 2 MENAQUINONE-9 × 1 15-cis-1,2-dihydroneurosporene × 1 all-trans-1,2-dihydroneurosporene × 17	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RCEL_BLAVI
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain L； PDBConstruct 1–274； UniProt 1–274

Reaction center protein M chain

OrganismNot specified

UniProt P06010

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 54	Photosynthetic reaction center cytochrome c subunit × 1 （P07173） Reaction center protein L chain × 1 （P06009） Reaction center protein H chain × 1 （P06008） Light-harvesting protein B-1015 alpha chain × 17 （P04123） Light-harvesting protein B-1015 beta chain × 17 （P04124） Light-harvesting protein B-1015 gamma chain × 16 （P04126） HEME C × 4 BACTERIOCHLOROPHYLL B × 38 BACTERIOPHEOPHYTIN B × 2 Ubiquinone-9 × 2 FE (III) ION × 1 SULFATE ION × 7 LAURYL DIMETHYLAMINE-N-OXIDE × 2 MENAQUINONE-9 × 1 15-cis-1,2-dihydroneurosporene × 1 all-trans-1,2-dihydroneurosporene × 17	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RCEM_BLAVI
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain M； PDBConstruct 1–323； UniProt 2–324

Reaction center protein H chain

OrganismNot specified

UniProt P06008

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 54	Photosynthetic reaction center cytochrome c subunit × 1 （P07173） Reaction center protein L chain × 1 （P06009） Reaction center protein M chain × 1 （P06010） Light-harvesting protein B-1015 alpha chain × 17 （P04123） Light-harvesting protein B-1015 beta chain × 17 （P04124） Light-harvesting protein B-1015 gamma chain × 16 （P04126） HEME C × 4 BACTERIOCHLOROPHYLL B × 38 BACTERIOPHEOPHYTIN B × 2 Ubiquinone-9 × 2 FE (III) ION × 1 SULFATE ION × 7 LAURYL DIMETHYLAMINE-N-OXIDE × 2 MENAQUINONE-9 × 1 15-cis-1,2-dihydroneurosporene × 1 all-trans-1,2-dihydroneurosporene × 17	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RCEH_BLAVI
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain H； PDBConstruct 1–258； UniProt 1–258

Light-harvesting protein B-1015 alpha chain

OrganismNot specified

UniProt P04123

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 54	Photosynthetic reaction center cytochrome c subunit × 1 （P07173） Reaction center protein L chain × 1 （P06009） Reaction center protein M chain × 1 （P06010） Reaction center protein H chain × 1 （P06008） Light-harvesting protein B-1015 beta chain × 17 （P04124） Light-harvesting protein B-1015 gamma chain × 16 （P04126） HEME C × 4 BACTERIOCHLOROPHYLL B × 38 BACTERIOPHEOPHYTIN B × 2 Ubiquinone-9 × 2 FE (III) ION × 1 SULFATE ION × 7 LAURYL DIMETHYLAMINE-N-OXIDE × 2 MENAQUINONE-9 × 1 15-cis-1,2-dihydroneurosporene × 1 all-trans-1,2-dihydroneurosporene × 17	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	LHA_BLAVI
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain 3； PDBConstruct 1–59； UniProt 1–59 Author chain 6； PDBConstruct 1–59； UniProt 1–59 Author chain F； PDBConstruct 1–59； UniProt 1–59 Author chain K； PDBConstruct 1–59； UniProt 1–59 Author chain P； PDBConstruct 1–59； UniProt 1–59 Author chain S； PDBConstruct 1–59； UniProt 1–59 Author chain V； PDBConstruct 1–59； UniProt 1–59 Author chain Y； PDBConstruct 1–59； UniProt 1–59 Author chain b； PDBConstruct 1–59； UniProt 1–59 Author chain e； PDBConstruct 1–59； UniProt 1–59 Author chain h； PDBConstruct 1–59； UniProt 1–59 Author chain k； PDBConstruct 1–59； UniProt 1–59 Author chain n； PDBConstruct 1–59； UniProt 1–59 Author chain q； PDBConstruct 1–59； UniProt 1–59 Author chain t； PDBConstruct 1–59； UniProt 1–59 Author chain w； PDBConstruct 1–59； UniProt 1–59 Author chain z； PDBConstruct 1–59； UniProt 1–59

Light-harvesting protein B-1015 beta chain

OrganismNot specified

UniProt P04124

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 54	Photosynthetic reaction center cytochrome c subunit × 1 （P07173） Reaction center protein L chain × 1 （P06009） Reaction center protein M chain × 1 （P06010） Reaction center protein H chain × 1 （P06008） Light-harvesting protein B-1015 alpha chain × 17 （P04123） Light-harvesting protein B-1015 gamma chain × 16 （P04126） HEME C × 4 BACTERIOCHLOROPHYLL B × 38 BACTERIOPHEOPHYTIN B × 2 Ubiquinone-9 × 2 FE (III) ION × 1 SULFATE ION × 7 LAURYL DIMETHYLAMINE-N-OXIDE × 2 MENAQUINONE-9 × 1 15-cis-1,2-dihydroneurosporene × 1 all-trans-1,2-dihydroneurosporene × 17	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	LHB_BLAVI
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain 1； PDBConstruct 1–56； UniProt 1–56 Author chain 4； PDBConstruct 1–56； UniProt 1–56 Author chain 7； PDBConstruct 1–56； UniProt 1–56 Author chain G； PDBConstruct 1–56； UniProt 1–56 Author chain N； PDBConstruct 1–56； UniProt 1–56 Author chain Q； PDBConstruct 1–56； UniProt 1–56 Author chain T； PDBConstruct 1–56； UniProt 1–56 Author chain W； PDBConstruct 1–56； UniProt 1–56 Author chain Z； PDBConstruct 1–56； UniProt 1–56 Author chain c； PDBConstruct 1–56； UniProt 1–56 Author chain f； PDBConstruct 1–56； UniProt 1–56 Author chain i； PDBConstruct 1–56； UniProt 1–56 Author chain l； PDBConstruct 1–56； UniProt 1–56 Author chain o； PDBConstruct 1–56； UniProt 1–56 Author chain r； PDBConstruct 1–56； UniProt 1–56 Author chain u； PDBConstruct 1–56； UniProt 1–56 Author chain x； PDBConstruct 1–56； UniProt 1–56

Light-harvesting protein B-1015 gamma chain

OrganismNot specified

UniProt P04126

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 54	Photosynthetic reaction center cytochrome c subunit × 1 （P07173） Reaction center protein L chain × 1 （P06009） Reaction center protein M chain × 1 （P06010） Reaction center protein H chain × 1 （P06008） Light-harvesting protein B-1015 alpha chain × 17 （P04123） Light-harvesting protein B-1015 beta chain × 17 （P04124） HEME C × 4 BACTERIOCHLOROPHYLL B × 38 BACTERIOPHEOPHYTIN B × 2 Ubiquinone-9 × 2 FE (III) ION × 1 SULFATE ION × 7 LAURYL DIMETHYLAMINE-N-OXIDE × 2 MENAQUINONE-9 × 1 15-cis-1,2-dihydroneurosporene × 1 all-trans-1,2-dihydroneurosporene × 17	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	LHG_BLAVI
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain 2； PDBConstruct 1–24； UniProt 13–36 Author chain 5； PDBConstruct 1–24； UniProt 13–36 Author chain I； PDBConstruct 1–24； UniProt 13–36 Author chain O； PDBConstruct 1–24； UniProt 13–36 Author chain R； PDBConstruct 1–24； UniProt 13–36 Author chain U； PDBConstruct 1–24； UniProt 13–36 Author chain X； PDBConstruct 1–24； UniProt 13–36 Author chain a； PDBConstruct 1–24； UniProt 13–36 Author chain d； PDBConstruct 1–24； UniProt 13–36 Author chain g； PDBConstruct 1–24； UniProt 13–36 Author chain j； PDBConstruct 1–24； UniProt 13–36 Author chain m； PDBConstruct 1–24； UniProt 13–36 Author chain p； PDBConstruct 1–24； UniProt 13–36 Author chain s； PDBConstruct 1–24； UniProt 13–36 Author chain v； PDBConstruct 1–24； UniProt 13–36 Author chain y； PDBConstruct 1–24； UniProt 13–36

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6et5
Deposition date deposition_date	2017-10-25
Structure title title	Reaction centre light harvesting complex 1 from Blc. virids
Keywords keywords	Reaction centre light harvesting complex 1 Blc. viridis Cryo-EM RC-LH1 Photosynthesis, PHOTOSYNTHESIS; PHOTOSYNTHESIS
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6et5__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6et5__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6et5__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	48.80 Å
Rg (electron density)	47.65 Å
Total Rg	48.17 Å
Atom count	31994
Residues	3491
Excluded volume	593080 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6et5__assembly_1__model_1`	54-meric （54）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (17)

Entity 1 Entity 1 polymer

Description description	Photosynthetic reaction center cytochrome c subunit
Molecular weight formula_weight	37179.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C
Atom count atom_count	31994

CFEPPPATTTQTGFRGLSMGEVLHPATVKAKKERDAQYPPALAAVKAEGPPVSQVYKNVKVLGNLTEAEFLRTMTAITEWVSPQEGCTYCHDENNLASEAKYPYVVARRMLEMTRAINTNWTQHVAQTGVTCYTCHRGTPLPPYVRYLEPTLPLNNRETPTHVERVETRSGYVVRLAKYTAYSALNYDPFTMFLANDKRQVRVVPQTALPLVGVSRGKERRPLSDAYATFALMMSISDSLGTNCTFCHNAQTFESWGKKSTPQRAIAWWGIRMVRDLNMNYLAPLNASLPASRLGRQGEAPQADCRTCHQGVTKPLFGASRLKDYPELGPIKA

Entity 2 Entity 2 polymer

Description description	Reaction center protein L chain
Molecular weight formula_weight	30600.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

MALLSFERKYRVRGGTLIGGDLFDFWVGPYFVGFFGVSAIFFIFLGVSLIGYAASQGPTWDPFAISINPPDLKYGLGAAPLLEGGFWQAITVCALGAFISWMLREVEISRKLGIGWHVPLAFCVPIFMFCVLQVFRPLLLGSWGHAFPYGILSHLDWVNNFGYQYLNWHYNPGHMSSVSFLFVNAMALGLHGGLILSVANPGDGDKVKTAEHENQYFRDVVGYSIGALSIHRLGLFLASNIFLTGAFGTIASGPFWTRGWPEWWGWWLDIPFWS

Entity 3 Entity 3 polymer

Description description	Reaction center protein M chain
Molecular weight formula_weight	35932.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M

ADYQTIYTQIQARGPHITVSGEWGDNDRVGKPFYSYWLGKIGDAQIGPIYLGASGIAAFAFGSTAILIILFNMAAEVHFDPLQFFRQFFWLGLYPPKAQYGMGIPPLHDGGWWLMAGLFMTLSLGSWWIRVYSRARALGLGTHIAWNFAAAIFFVLCIGCIHPTLVGSWSEGVPFGIWPHIDWLTAFSIRYGNFYYCPWHGFSIGFAYGCGLLFAAHGATILAVARFGGDREIEQITDRGTAVERAALFWRWTIGFNATIESVHRWGWFFSLMVMVSASVGILLTGTFVDNWYLWCVKHGAAPDYPAYLPATPDPASLPGAPK

Entity 4 Entity 4 polymer

Description description	Reaction center protein H chain
Molecular weight formula_weight	28557.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

MYHGALAQHLDIAQLVWYAQWLVIWTVVLLYLRREDRREGYPLVEPLGLVKLAPEDGQVYELPYPKTFVLPHGGTVTVPRRRPETRELKLAQTDGFEGAPLQPTGNPLVDAVGPASYAERAEVVDATVDGKAKIVPLRVATDFSIAEGDVDPRGLPVVAADGVEAGTVTDLWVDRSEHYFRYLELSVAGSARTALIPLGFCDVKKDKIVVTSILSEQFANVPRLQSRDQITLREEDKVSAYYAGGLLYATPERAESLL

Entity 5 Entity 5 polymer

Description description	Light-harvesting protein B-1015 alpha chain
Molecular weight formula_weight	6984.3 kDa
Source method src_method	nat
Copy count entity_count	17

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	z,F,K,P,S,V,Y,b,e,h,k,n,q,t,w,3,6

MATEYRTASWKLWLILDPRRVLTALFVYLTVIALLIHFGLLSTDRLNWWEFQRGLPKAA

Entity 6 Entity 6 polymer

Description description	Light-harvesting protein B-1015 beta chain
Molecular weight formula_weight	6274.3 kDa
Source method src_method	nat
Copy count entity_count	17

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	1,G,N,Q,T,W,Z,c,f,i,l,o,r,u,x,4,7

MADLKPSLTGLTEEEAKEFHGIFVTSTVLYLATAVIVHYLVWTARPWIAPIPKGWV

Entity 7 Entity 7 polymer

Description description	Light-harvesting protein B-1015 gamma chain
Molecular weight formula_weight	2799.3 kDa
Source method src_method	nat
Copy count entity_count	16

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	2,I,O,R,U,X,a,d,g,j,m,p,s,v,y,5

SDWNLWVPLGILGIPTIWIALTYR

Entity 8 Entity 8 non-polymer

Description description	HEME C
Molecular weight formula_weight	618.5 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 9 Entity 9 non-polymer

Description description	BACTERIOCHLOROPHYLL B
Molecular weight formula_weight	909.5 kDa
Source method src_method	syn
Copy count entity_count	38

Entity 10 Entity 10 non-polymer

Description description	BACTERIOPHEOPHYTIN B
Molecular weight formula_weight	887.2 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 11 Entity 11 non-polymer

Description description	Ubiquinone-9
Molecular weight formula_weight	795.2 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 12 Entity 12 non-polymer

Description description	FE (III) ION
Molecular weight formula_weight	55.8 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 13 Entity 13 non-polymer

Description description	SULFATE ION
Molecular weight formula_weight	96.1 kDa
Source method src_method	syn
Copy count entity_count	7

Entity 14 Entity 14 non-polymer

Description description	LAURYL DIMETHYLAMINE-N-OXIDE
Molecular weight formula_weight	229.4 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 15 Entity 15 non-polymer

Description description	MENAQUINONE-9
Molecular weight formula_weight	785.2 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 16 Entity 16 non-polymer

Description description	15-cis-1,2-dihydroneurosporene
Molecular weight formula_weight	540.9 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 17 Entity 17 non-polymer

Description description	all-trans-1,2-dihydroneurosporene
Molecular weight formula_weight	540.9 kDa
Source method src_method	syn
Copy count entity_count	17

▼

6. Fold Classification (SCOP + CATH) 54 domains

SCOP 2.08 (29 domains)

Domain ID domain_id	d6et51_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.3 — Light-harvesting complex subunits
Superfamily Superfamily superfamily	f.3.1 — Light-harvesting complex subunits
Family Family family	f.3.1.0 — automated matches

Domain ID domain_id	d6et53_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.3 — Light-harvesting complex subunits
Superfamily Superfamily superfamily	f.3.1 — Light-harvesting complex subunits
Family Family family	f.3.1.0 — automated matches

Domain ID domain_id	d6et54_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.3 — Light-harvesting complex subunits
Superfamily Superfamily superfamily	f.3.1 — Light-harvesting complex subunits
Family Family family	f.3.1.0 — automated matches

Domain ID domain_id	d6et56_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.3 — Light-harvesting complex subunits
Superfamily Superfamily superfamily	f.3.1 — Light-harvesting complex subunits
Family Family family	f.3.1.0 — automated matches

Domain ID domain_id	d6et57_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.3 — Light-harvesting complex subunits
Superfamily Superfamily superfamily	f.3.1 — Light-harvesting complex subunits
Family Family family	f.3.1.0 — automated matches

Domain ID domain_id	d6et5b_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.3 — Light-harvesting complex subunits
Superfamily Superfamily superfamily	f.3.1 — Light-harvesting complex subunits
Family Family family	f.3.1.0 — automated matches

Domain ID domain_id	d6et5c_
Class class	a — All alpha proteins
Fold Fold fold	a.138 — Multiheme cytochromes
Superfamily Superfamily superfamily	a.138.1 — Multiheme cytochromes
Family Family family	a.138.1.2 — Photosynthetic reaction centre (cytochrome subunit)

Domain ID domain_id	d6et5e_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.3 — Light-harvesting complex subunits
Superfamily Superfamily superfamily	f.3.1 — Light-harvesting complex subunits
Family Family family	f.3.1.0 — automated matches

Domain ID domain_id	d6et5f_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.3 — Light-harvesting complex subunits
Superfamily Superfamily superfamily	f.3.1 — Light-harvesting complex subunits
Family Family family	f.3.1.0 — automated matches

Domain ID domain_id	d6et5g_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.3 — Light-harvesting complex subunits
Superfamily Superfamily superfamily	f.3.1 — Light-harvesting complex subunits
Family Family family	f.3.1.0 — automated matches

Domain ID domain_id	d6et5h1
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.23 — Single transmembrane helix
Superfamily Superfamily superfamily	f.23.10 — Photosystem II reaction centre subunit H, transmembrane region
Family Family family	f.23.10.0 — automated matches

Domain ID domain_id	d6et5h2
Class class	b — All beta proteins
Fold Fold fold	b.41 — PRC-barrel domain
Superfamily Superfamily superfamily	b.41.1 — PRC-barrel domain
Family Family family	b.41.1.1 — Photosynthetic reaction centre, H-chain, cytoplasmic domain

Domain ID domain_id	d6et5i_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.3 — Light-harvesting complex subunits
Superfamily Superfamily superfamily	f.3.1 — Light-harvesting complex subunits
Family Family family	f.3.1.0 — automated matches

Domain ID domain_id	d6et5k_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.3 — Light-harvesting complex subunits
Superfamily Superfamily superfamily	f.3.1 — Light-harvesting complex subunits
Family Family family	f.3.1.0 — automated matches

Domain ID domain_id	d6et5l_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.3 — Light-harvesting complex subunits
Superfamily Superfamily superfamily	f.3.1 — Light-harvesting complex subunits
Family Family family	f.3.1.0 — automated matches

Domain ID domain_id	d6et5m_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.26 — Bacterial photosystem II reaction centre, L and M subunits
Superfamily Superfamily superfamily	f.26.1 — Bacterial photosystem II reaction centre, L and M subunits
Family Family family	f.26.1.1 — Bacterial photosystem II reaction centre, L and M subunits

Domain ID domain_id	d6et5n_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.3 — Light-harvesting complex subunits
Superfamily Superfamily superfamily	f.3.1 — Light-harvesting complex subunits
Family Family family	f.3.1.0 — automated matches

Domain ID domain_id	d6et5o_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.3 — Light-harvesting complex subunits
Superfamily Superfamily superfamily	f.3.1 — Light-harvesting complex subunits
Family Family family	f.3.1.0 — automated matches

Domain ID domain_id	d6et5p_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.3 — Light-harvesting complex subunits
Superfamily Superfamily superfamily	f.3.1 — Light-harvesting complex subunits
Family Family family	f.3.1.0 — automated matches

Domain ID domain_id	d6et5q_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.3 — Light-harvesting complex subunits
Superfamily Superfamily superfamily	f.3.1 — Light-harvesting complex subunits
Family Family family	f.3.1.0 — automated matches

Domain ID domain_id	d6et5r_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.3 — Light-harvesting complex subunits
Superfamily Superfamily superfamily	f.3.1 — Light-harvesting complex subunits
Family Family family	f.3.1.0 — automated matches

Domain ID domain_id	d6et5s_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.3 — Light-harvesting complex subunits
Superfamily Superfamily superfamily	f.3.1 — Light-harvesting complex subunits
Family Family family	f.3.1.0 — automated matches

Domain ID domain_id	d6et5t_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.3 — Light-harvesting complex subunits
Superfamily Superfamily superfamily	f.3.1 — Light-harvesting complex subunits
Family Family family	f.3.1.0 — automated matches

Domain ID domain_id	d6et5u_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.3 — Light-harvesting complex subunits
Superfamily Superfamily superfamily	f.3.1 — Light-harvesting complex subunits
Family Family family	f.3.1.0 — automated matches

Domain ID domain_id	d6et5v_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.3 — Light-harvesting complex subunits
Superfamily Superfamily superfamily	f.3.1 — Light-harvesting complex subunits
Family Family family	f.3.1.0 — automated matches

Domain ID domain_id	d6et5w_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.3 — Light-harvesting complex subunits
Superfamily Superfamily superfamily	f.3.1 — Light-harvesting complex subunits
Family Family family	f.3.1.0 — automated matches

Domain ID domain_id	d6et5x_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.3 — Light-harvesting complex subunits
Superfamily Superfamily superfamily	f.3.1 — Light-harvesting complex subunits
Family Family family	f.3.1.0 — automated matches

Domain ID domain_id	d6et5y_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.3 — Light-harvesting complex subunits
Superfamily Superfamily superfamily	f.3.1 — Light-harvesting complex subunits
Family Family family	f.3.1.0 — automated matches

Domain ID domain_id	d6et5z_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.3 — Light-harvesting complex subunits
Superfamily Superfamily superfamily	f.3.1 — Light-harvesting complex subunits
Family Family family	f.3.1.0 — automated matches

CATH v4.4 (25 domains)

Domain ID domain_id	6et5300
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	220 — Light-harvesting Protein
Homologous superfamily homologous superfamily	20 — Light-harvesting complex

Domain ID domain_id	6et5600
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	220 — Light-harvesting Protein
Homologous superfamily homologous superfamily	20 — Light-harvesting complex

Domain ID domain_id	6et5C01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	468 — Photosynthetic Reaction Center, subunit C; domain 2
Homologous superfamily homologous superfamily	10 — Photosynthetic Reaction Center, subunit C, domain 2

Domain ID domain_id	6et5C02
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	468 — Photosynthetic Reaction Center, subunit C; domain 2
Homologous superfamily homologous superfamily	10 — Photosynthetic Reaction Center, subunit C, domain 2

Domain ID domain_id	6et5F00
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	220 — Light-harvesting Protein
Homologous superfamily homologous superfamily	20 — Light-harvesting complex

Domain ID domain_id	6et5H01
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	540 — Photosynthetic Reaction Center; Chain H, domain 1
Homologous superfamily homologous superfamily	10 — Photosynthetic reaction centre, H subunit, N-terminal domain

Domain ID domain_id	6et5H02
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	50 — Photosynthetic Reaction Center; Chain H, domain 2
Homologous superfamily homologous superfamily	10 — Photosynthetic Reaction Center, subunit H, domain 2

Domain ID domain_id	6et5K00
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	220 — Light-harvesting Protein
Homologous superfamily homologous superfamily	20 — Light-harvesting complex

Domain ID domain_id	6et5L01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	85 — Photosynthetic Reaction Center, subunit M; domain 1
Homologous superfamily homologous superfamily	10 — Photosystem II protein D1-like

Domain ID domain_id	6et5L02
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	85 — Photosynthetic Reaction Center, subunit M; domain 1
Homologous superfamily homologous superfamily	10 — Photosystem II protein D1-like

Domain ID domain_id	6et5M01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	85 — Photosynthetic Reaction Center, subunit M; domain 1
Homologous superfamily homologous superfamily	10 — Photosystem II protein D1-like

Domain ID domain_id	6et5M02
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	85 — Photosynthetic Reaction Center, subunit M; domain 1
Homologous superfamily homologous superfamily	10 — Photosystem II protein D1-like

Domain ID domain_id	6et5P00
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	220 — Light-harvesting Protein
Homologous superfamily homologous superfamily	20 — Light-harvesting complex

Domain ID domain_id	6et5S00
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	220 — Light-harvesting Protein
Homologous superfamily homologous superfamily	20 — Light-harvesting complex

Domain ID domain_id	6et5V00
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	220 — Light-harvesting Protein
Homologous superfamily homologous superfamily	20 — Light-harvesting complex

Domain ID domain_id	6et5Y00
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	220 — Light-harvesting Protein
Homologous superfamily homologous superfamily	20 — Light-harvesting complex

Domain ID domain_id	6et5b00
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	220 — Light-harvesting Protein
Homologous superfamily homologous superfamily	20 — Light-harvesting complex

Domain ID domain_id	6et5e00
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	220 — Light-harvesting Protein
Homologous superfamily homologous superfamily	20 — Light-harvesting complex

Domain ID domain_id	6et5h00
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	220 — Light-harvesting Protein
Homologous superfamily homologous superfamily	20 — Light-harvesting complex

Domain ID domain_id	6et5k00
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	220 — Light-harvesting Protein
Homologous superfamily homologous superfamily	20 — Light-harvesting complex

Domain ID domain_id	6et5n00
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	220 — Light-harvesting Protein
Homologous superfamily homologous superfamily	20 — Light-harvesting complex

Domain ID domain_id	6et5q00
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	220 — Light-harvesting Protein
Homologous superfamily homologous superfamily	20 — Light-harvesting complex

Domain ID domain_id	6et5t00
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	220 — Light-harvesting Protein
Homologous superfamily homologous superfamily	20 — Light-harvesting complex

Domain ID domain_id	6et5w00
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	220 — Light-harvesting Protein
Homologous superfamily homologous superfamily	20 — Light-harvesting complex

Domain ID domain_id	6et5z00
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	220 — Light-harvesting Protein
Homologous superfamily homologous superfamily	20 — Light-harvesting complex

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	1

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	2.870 Å
Low-resolution limit resolution_low	2.870 Å
R factor r_factor	0.3520
R_work r_work	0.3520
R_free r_free	—

Resolution resolution	2.87 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	267726

Reaction centre light harvesting complex 1 from Blc. virids

1. Protein Identity and Related Structures Protein Identity & Related Structures

Photosynthetic reaction center cytochrome c subunit

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Reaction center protein L chain

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Reaction center protein M chain

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Reaction center protein H chain

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Light-harvesting protein B-1015 alpha chain

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Light-harvesting protein B-1015 beta chain

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Light-harvesting protein B-1015 gamma chain

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6et5__assembly_1__model_1

6et5__assembly_1__model_1 | I(q)

6et5__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (17)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 polymer

Polymer Polymer

Entity 6 Entity 6 polymer