SAXSdb — 6ggr

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Transcription factor p65

Mus musculus

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain A； UniProt 20–188	Not recorded	Bacteriophage virulence determinant × 1 （A0A0F6AZI6） CL CHLORIDE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；293 K；Crystallyzation conditions: 0.1 M Tris pH 8.3, 0.5 M LiCl and 32.5% (w/v) PEG 6000	Resolution 2.10 Å R-free 0.252

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 6GGR	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1BFT STRUCTURE OF NF-KB P65 HOMODIMER BOUND TO A KB SITE Deposited 1997-09-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 191–291（101 aa） Fragment：DIMERIZATION DOMAIN Chain B 191–291（101 aa） Fragment：DIMERIZATION DOMAIN	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.00 Å R-free 0.294
1IKN IKAPPABALPHA/NF-KAPPAB COMPLEX Deposited 1998-11-13	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 19–304（286 aa） Fragment：N-TERMINAL AND DIMERIZATION DOMAINS	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 7；pH 7.00	Resolution 2.30 Å R-free 0.277
1K3Z X-ray crystal structure of the IkBb/NF-kB p65 homodimer complex Deposited 2001-10-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 191–326（136 aa） Fragment：p65 dimerization domain Chain B 191–326（136 aa） Fragment：p65 dimerization domain	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.50 Å R-free 0.256
1LE5 Crystal structure of a NF-kB heterodimer bound to an IFNb-kB Deposited 2002-04-09	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 2 PDB declaration: tetrameric	Chain A 20–291（272 aa） Fragment：p65 RHR	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.5；291 K；50 mM Na acatate, 50mM CaCl2, 1.0 mM Na spermine, 8% PEG 3350, pH 5.5, VAPOR DIFFUSION, HANGING DROP, temperature 291K	Resolution 2.75 Å R-free 0.293
1LE5 Crystal structure of a NF-kB heterodimer bound to an IFNb-kB Deposited 2002-04-09	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein–DNA Heteromer；Protein × 2 PDB declaration: tetrameric	Chain E 20–291（272 aa） Fragment：p65 RHR	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.5；291 K；50 mM Na acatate, 50mM CaCl2, 1.0 mM Na spermine, 8% PEG 3350, pH 5.5, VAPOR DIFFUSION, HANGING DROP, temperature 291K	Resolution 2.75 Å R-free 0.293
1LE9 Crystal structure of a NF-kB heterodimer bound to the Ig/HIV-kB siti Deposited 2002-04-09	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 2 PDB declaration: tetrameric	Chain A 20–291（272 aa） Fragment：p65 RHR	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.5；PEG 3350, CaCl2, Na acetate, pH 5.5, VAPOR DIFFUSION, HANGING DROP, temperature 110K	Resolution 3.00 Å R-free 0.305
1LE9 Crystal structure of a NF-kB heterodimer bound to the Ig/HIV-kB siti Deposited 2002-04-09	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein–DNA Heteromer；Protein × 2 PDB declaration: tetrameric	Chain E 20–291（272 aa） Fragment：p65 RHR	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.5；PEG 3350, CaCl2, Na acetate, pH 5.5, VAPOR DIFFUSION, HANGING DROP, temperature 110K	Resolution 3.00 Å R-free 0.305
1LEI The kB DNA sequence from the HLV-LTR functions as an allosteric regulator of HIV transcription Deposited 2002-04-09	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 2 PDB declaration: tetrameric	Chain A 20–291（272 aa） Fragment：p65 RHR	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions SMALL TUBES；pH 6.5；291 K；PEG 3350, CaCl2, sodium spermine, pH 6.5, SMALL TUBES, temperature 291K	Resolution 2.70 Å R-free 0.284
1MY5 NF-kappaB p65 subunit dimerization domain homodimer Deposited 2002-10-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 191–304（114 aa） Fragment：residues 191-304 (dimerization domain) Chain B 191–304（114 aa） Fragment：residues 191-304 (dimerization domain)	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；291 K；0.1M sodium HEPES, 0.2M sodium tartrate, 2M ammonium sulfate, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 291K	Resolution 1.80 Å R-free 0.221
1MY7 NF-kappaB p65 subunit dimerization domain homodimer N202R mutation Deposited 2002-10-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 191–304（114 aa） Fragment：residues 191 - 304 (dimerization domain) Chain B 191–304（114 aa） Fragment：residues 191 - 304 (dimerization domain)	Mutation：N202R Mutation：N202R	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；291 K；0.l M sodium HEPES, 0.2 M sodium tartrate, 2 M ammonium sulfate, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 291K	Resolution 1.49 Å R-free 0.247
1OY3 CRYSTAL STRUCTURE OF AN IKBBETA/NF-KB P65 HOMODIMER COMPLEX Deposited 2003-04-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain B 191–326（136 aa） Fragment：p65 dimerization domain Chain C 191–326（136 aa） Fragment：p65 dimerization domain	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.8；291 K；PEG 8000, pH 5.8, VAPOR DIFFUSION, HANGING DROP, temperature 291K	Resolution 2.05 Å R-free 0.247
1RAM A NOVEL DNA RECOGNITION MODE BY NF-KB P65 HOMODIMER Deposited 1997-11-22	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 2 PDB declaration: tetrameric	Chain A 19–291（273 aa） Fragment：P65 SUBUNIT, RESIDUES 19 - 291 Chain B 19–291（273 aa） Fragment：P65 SUBUNIT, RESIDUES 19 - 291	Not recorded	DTT 2,3-DIHYDROXY-1,4-DITHIOBUTANE × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；291 K；crystallized from PEG 3350, CACL2, BETA-OCTYL GLUCOPYRANOSIDE, HEPES and GLYCEROL, pH 7.50, VAPOR DIFFUSION, HANGING DROP, temperature 291.00K	Resolution 2.70 Å R-free 0.324
1VKX CRYSTAL STRUCTURE OF THE NFKB P50/P65 HETERODIMER COMPLEXED TO THE IMMUNOGLOBULIN KB DNA Deposited 1997-09-17	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 2 PDB declaration: tetrameric	Chain A 19–291（273 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.5；pH 5.50, VAPOR DIFFUSION, HANGING DROP	Resolution 2.90 Å R-free 0.320
2I9T Structure of NF-kB p65-p50 heterodimer bound to PRDII element of B-interferon promoter Deposited 2006-09-06	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 2 PDB declaration: tetrameric	Chain A 19–291（273 aa） Fragment：residues 19-291	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 5.6；293 K；8% PEG 5K monomethylether, 200mM sodium acetate, pH 5.6, VAPOR DIFFUSION, HANGING DROP, temperature 293K, pH 5.60	Resolution 2.80 Å R-free 0.288
2RAM A NOVEL DNA RECOGNITION MODE BY NF-KB P65 HOMODIMER Deposited 1997-11-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 2 PDB declaration: tetrameric	Chain A 19–291（273 aa） Fragment：P65 RESIDUES 19 - 291 Chain B 19–291（273 aa） Fragment：P65 RESIDUES 19 - 291	Not recorded	DTV (2S,3S)-1,4-DIMERCAPTOBUTANE-2,3-DIOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.5；pH 7.5	Resolution 2.40 Å R-free 0.308
5U01 Cooperative DNA binding by two RelA dimers Deposited 2016-11-22	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 4 PDB declaration: hexameric	Chain A 19–291（273 aa） Fragment：UNP residues 19-291 Chain B 19–291（273 aa） Fragment：UNP residues 19-291 Chain C 19–291（273 aa） Fragment：UNP residues 19-291 Chain D 19–291（273 aa） Fragment：UNP residues 19-291	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 5.5；293 K；Nacit 5.5 100mM, CaCl2 10mM, DTT 10mM, PEG 3350 15%.	Resolution 2.50 Å R-free 0.274
8U9L Crystal Structure of RelA-cRel chimera complex with DNA Deposited 2023-09-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Homooligomer；Protein × 2 PDB declaration: tetrameric	Chain A 19–98（80 aa） Chain A 191–291（101 aa） Chain B 19–98（80 aa） Chain B 191–291（101 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；291 K；0.2M Sodium/Potassium phosphate 0.1M Bis Tris propane pH 6.5 20% PEG 3350 10mM DTT 0.5% BOG	Resolution 3.09 Å R-free 0.329
8U9L Crystal Structure of RelA-cRel chimera complex with DNA Deposited 2023-09-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Homooligomer；Protein × 2 PDB declaration: tetrameric	Chain G 19–98（80 aa） Chain G 191–291（101 aa） Chain H 19–98（80 aa） Chain H 191–291（101 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；291 K；0.2M Sodium/Potassium phosphate 0.1M Bis Tris propane pH 6.5 20% PEG 3350 10mM DTT 0.5% BOG	Resolution 3.09 Å R-free 0.329
8U9L Crystal Structure of RelA-cRel chimera complex with DNA Deposited 2023-09-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Insufficient information Homooligomer；Protein × 2 PDB declaration: tetrameric	Chain K 19–98（80 aa） Chain K 191–291（101 aa） Chain L 19–98（80 aa） Chain L 191–291（101 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；291 K；0.2M Sodium/Potassium phosphate 0.1M Bis Tris propane pH 6.5 20% PEG 3350 10mM DTT 0.5% BOG	Resolution 3.09 Å R-free 0.329
8U9L Crystal Structure of RelA-cRel chimera complex with DNA Deposited 2023-09-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Insufficient information Homooligomer；Protein × 2 PDB declaration: tetrameric	Chain O 19–98（80 aa） Chain O 191–291（101 aa） Chain P 19–98（80 aa） Chain P 191–291（101 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；291 K；0.2M Sodium/Potassium phosphate 0.1M Bis Tris propane pH 6.5 20% PEG 3350 10mM DTT 0.5% BOG	Resolution 3.09 Å R-free 0.329
9BDU NF-kappaB RelA homo-dimer bound to AT-centric kappaB DNA Deposited 2024-04-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 2 PDB declaration: tetrameric	Chain A 19–304（286 aa） Fragment：residues 19-304 Chain B 19–304（286 aa） Fragment：residues 19-304	Not recorded	SO4 SULFATE ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；PEG3350, MES, beta-octylglucoside, spermine	Resolution 2.03 Å R-free 0.273
9BDV NF-kappaB RelA homo-dimer bound to TA-centric kappaB DNA Deposited 2024-04-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 2 PDB declaration: tetrameric	Chain A 19–304（286 aa） Fragment：residues 19-304 Chain B 19–304（286 aa） Fragment：residues 19-304	Not recorded	SO4 SULFATE ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；PEG3350, MES, Spermine, beta-octylglucoside	Resolution 1.90 Å R-free 0.230
9BDW NF-kappaB RelA homo-dimer bound to GC-centric kappaB DNA Deposited 2024-04-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 2 PDB declaration: tetrameric	Chain A 19–304（286 aa） Fragment：residues 19-304 Chain B 19–304（286 aa） Fragment：residues 19-304	Not recorded	SO4 SULFATE ION × 5 BOG octyl beta-D-glucopyranoside × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；PEG3350, MES, Spermine, beta-octylglucoside	Resolution 1.87 Å R-free 0.227
9BDX NF-kappaB RelA homo-dimer bound to CG-centric kappaB DNA Deposited 2024-04-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 2 PDB declaration: tetrameric	Chain A 19–304（286 aa） Fragment：residues 19-304 Chain B 19–304（286 aa） Fragment：residues 19-304	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；PEG3350, MES, Spermine, beta-octylglucoside	Resolution 3.60 Å R-free 0.374
9E6W NF-kappaB RelA homo-dimer bound to a kappaB site of Cxcl2 gene Deposited 2024-10-31	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 2 PDB declaration: tetrameric	Chain A 19–304（286 aa） Fragment：residues 19-304 Chain B 19–304（286 aa） Fragment：residues 19-304	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；Tris HCl 25mM pH 7.5, NaCl 50 mM, DTT 1 mM, MES 50 mM pH 5.5, CaCl2 2 mM, Spermidine 1 mM, b-D-octylglucopyranoside 0.05%, Ammonium chloride 50 mM, PEG3350 14%	Resolution 2.04 Å R-free 0.283

20 other PDB entries and 25 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	TF65_MOUSE
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 2–170； UniProt 20–188

Bacteriophage virulence determinant

Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S

UniProt A0A0F6AZI6

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain B； UniProt 20–228	Not recorded	Transcription factor p65 × 1 （Q04207） CL CHLORIDE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；293 K；Crystallyzation conditions: 0.1 M Tris pH 8.3, 0.5 M LiCl and 32.5% (w/v) PEG 6000	Resolution 2.10 Å R-free 0.252

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 6GGR	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6GGO Crystal structure of Salmonella zinc metalloprotease effector GtgA Deposited 2018-05-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 20–228（209 aa） Chain B 20–228（209 aa）	Not recorded	ZN ZINC ION × 2 CL CHLORIDE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；GtgA, at a concentration of 24 mg/ml, was crystallyzed in 0.1 M Tris pH 8.5, 25% (v/v) isopropanol and 20% (w/v) PEG 3350	Resolution 2.60 Å R-free 0.255

1 other PDB entries and 1 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	A0A0F6AZI6_SALT1
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 4–212； UniProt 20–228

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6ggr
Deposition date deposition_date	2018-05-03
Structure title title	Crystal structure of Salmonella zinc metalloprotease effector GtgA in complex with p65
Keywords keywords	Protease, Metalloprotease, zinc, METAL BINDING PROTEIN; METAL BINDING PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	22.95 Å
Radius of gyration Rg (electron density) rg_electron	22.31 Å
Forward intensity I(0) i0	31253900.00
Molecular weight molecular_weight	40924.0 kDa
Excluded volume excluded_volume	50323 Å³
Envelope volume envelope_volume	60552 Å³
Hydration-shell volume shell_volume	23142 Å³
Envelope diameter envelope_diameter	78.5 Å
Shell Rg shell_rg	28.63 Å
Envelope Rg envelope_rg	22.31 Å
Shape Rg shape_rg	22.31 Å
Total Rg total_rg	23.04 Å
Total atoms total_atoms	5622
Residues n_residues	359
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	76.6 Å
Rg (real space) rg_real	22.95 Å
Rg uncertainty (real space) rg_real_error	0.51 Å
I(0) (real space) i0_real	3.1250e+07
I(0) uncertainty (real space) i0_real_error	4.5280e+05
Rg (reciprocal space) rg_reciprocal	22.95 Å
I(0) (reciprocal space) i0_reciprocal	31250000.0000
Solution quality estimate total_estimate	0.8831
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	25.9 Å
Skewness Skewness skewness	0.370
Kurtosis Kurtosis kurtosis	-0.284
Angular range angular_range	— – 0.3450 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	7924000.0000
Real-space data points n_real_points	66
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.842; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.986; Smooth: 0.963

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	Transcription factor p65
Molecular weight formula_weight	19316.9 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	5771

AYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPTIKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGYYEADLCPDRSIHSFQNLGIQCVKKRDLEQAISQRIQTNNNPFHVPIEEQRGDYDLNAVRLCFQVTVRDPAGRPLLLTPVLSHPIFDNRA

来源 Source

来源生物 organism	Mus musculus
通用名 common_name	House Mouse
NCBI Class编号 ncbi_taxonomy_id	10090
宿主生物 host_organism	Escherichia coli K-12

Entity 2 Entity 2 polymer

Description description	Bacteriophage virulence determinant
Molecular weight formula_weight	24098.2 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

GAMSHPHDSKVFPDLPEHQDNPSQLRLQHDGLATDDKARLEPMCLAEYLISGPGGMDPDIEIDDDTYDECREVLSRILEDAYTQSGTFRRLMNYAYDQELHDVEQRWLLGAGENFGTTVTDEDLESSEGRKVIALNLDDTDDDSIPEYYESNDGPQQFDTTRSFIHQVVHALTHLQDKEDSNPRGPVVEYTNIILKEMGHTSPPRIAYEFSN

来源 Source

来源生物 organism	Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S
NCBI Class编号 ncbi_taxonomy_id	588858
宿主生物 host_organism	Escherichia coli K-12

Entity 3 Entity 3 non-polymer

Description description	CHLORIDE ION
Molecular weight formula_weight	35.5 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	149

▼

7. Fold Classification (SCOP + CATH) 3 domains

SCOP 2.08 (2 domains)

Domain ID domain_id	d6ggra1
Class class	b — All beta proteins
Fold Fold fold	b.2 — Common fold of diphtheria toxin/transcription factors/cytochrome f
Superfamily Superfamily superfamily	b.2.5 — p53-like transcription factors
Family Family family	b.2.5.3 — Rel/Dorsal transcription factors, DNA-binding domain

Domain ID domain_id	d6ggra2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

CATH v4.4 (1 domains)

Domain ID domain_id	6ggrA00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	340 — Rel homology domain (RHD), DNA-binding domain

▶

8. Citations (1)

▶

Unit-cell length a length_a	39.392 Å
Unit-cell length b length_b	85.833 Å
Unit-cell length c length_c	111.869 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	4

Space group space_group	P 21 21 21
Space-group number int_tables_number	19
Crystal system crystal_system	—

Resolution resolution	2.097 Å
Low-resolution limit resolution_low	55.930 Å
R factor r_factor	0.2084
R_work r_work	0.2061
R_free r_free	0.2520

fit	/app/data/saxs_computation/gg/6ggr/6ggr.fit
pddf	/app/data/pr_computation/gg/6ggr/6ggr.pr.out
profile	/app/data/saxs_computation/gg/6ggr/6ggr.dat

Crystal structure of Salmonella zinc metalloprotease effector GtgA in complex with p65

1. Protein Identity and Related Structures Protein Identity & Related Structures

Transcription factor p65

State in the Current Structure

Other States of the Same Protein in the Database

Bacteriophage virulence determinant

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

6. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

来源 Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

7. Fold Classification (SCOP + CATH) 3 domains

SCOP 2.08 (2 domains)

CATH v4.4 (1 domains)

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)