SAXSdb — 6gnw

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Transthyretin

Sparus aurata

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein homooligomer	Homooligomer	Protein 4	2-[2,4,5-tris(chloranyl)phenoxy]ethanoic acid × 2 water × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q9PTT3_SPAAU
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 4–133； UniProt 20–149 Author chain B； PDBConstruct 4–133； UniProt 20–149 Author chain C； PDBConstruct 4–133； UniProt 20–149 Author chain D； PDBConstruct 4–133； UniProt 20–149

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6gnw
Deposition date deposition_date	2018-05-31
Structure title title	Crystal Structure Of Sea Bream Transthyretin in complex with 2,4,5-trichlorophenoxyacetic acid (2,4,5-T)
Keywords keywords	transthyretin, transport protein, thyroxine disrupting chemicals, TDCs, 2, 4, 5-trichlorophenoxyacetic acid, 5-T; TRANSPORT PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6gnw__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6gnw__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6gnw__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	23.14 Å
Rg (electron density)	21.69 Å
Total Rg	22.59 Å
Atom count	3535
Residues	461
Excluded volume	62807 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6gnw__assembly_1__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Transthyretin
Molecular weight formula_weight	14455.1 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D
Atom count atom_count	4323

GAMAPTPTDKHGGSDTRCPLMVKILDAVKGTPAGSVALKVSQKTADGGWTQIATGVTDATGEIHNLITEQQFPAGVYRVEFDTKAYWTNQGSTPFHEVAEVVFDAHPEGHRHYTLALLLSPFSYTTTAVVSSVHE

Source Source

Source organism organism	Sparus aurata
Common name common_name	Gilthead sea bream
NCBI taxonomy ID ncbi_taxonomy_id	8175
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 non-polymer

Description description	2-[2,4,5-tris(chloranyl)phenoxy]ethanoic acid
Molecular weight formula_weight	255.5 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	609

▼

6. Fold Classification (SCOP + CATH) 4 domains

SCOP 2.08 (4 domains)

Domain ID domain_id	d6gnwa_
Class class	b — All beta proteins
Fold Fold fold	b.3 — Prealbumin-like
Superfamily Superfamily superfamily	b.3.4 — Transthyretin (synonym: prealbumin)
Family Family family	b.3.4.0 — automated matches

Domain ID domain_id	d6gnwb_
Class class	b — All beta proteins
Fold Fold fold	b.3 — Prealbumin-like
Superfamily Superfamily superfamily	b.3.4 — Transthyretin (synonym: prealbumin)
Family Family family	b.3.4.0 — automated matches

Domain ID domain_id	d6gnwc_
Class class	b — All beta proteins
Fold Fold fold	b.3 — Prealbumin-like
Superfamily Superfamily superfamily	b.3.4 — Transthyretin (synonym: prealbumin)
Family Family family	b.3.4.0 — automated matches

Domain ID domain_id	d6gnwd_
Class class	b — All beta proteins
Fold Fold fold	b.3 — Prealbumin-like
Superfamily Superfamily superfamily	b.3.4 — Transthyretin (synonym: prealbumin)
Family Family family	b.3.4.0 — automated matches

▶

Unit-cell length a length_a	72.061 Å
Unit-cell length b length_b	76.088 Å
Unit-cell length c length_c	107.456 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	16

Space group space_group	P 21 21 21
Space-group number int_tables_number	19
Crystal system crystal_system	—

Resolution resolution	1.750 Å
Low-resolution limit resolution_low	47.000 Å
R factor r_factor	0.1600
R_work r_work	0.1590
R_free r_free	0.1950

Crystal Structure Of Sea Bream Transthyretin in complex with 2,4,5-trichlorophenoxyacetic acid (2,4,5-T)

1. Protein Identity and Related Structures Protein Identity & Related Structures

Transthyretin

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6gnw__assembly_1__model_1

6gnw__assembly_1__model_1 | I(q)

6gnw__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 4 domains

SCOP 2.08 (4 domains)

7. Citations (2)

Crystal Structure Of Sea Bream Transthyretin in complex with 2,4,5-trichlorophenoxyacetic acid (2,4,5-T)

1. Protein Identity and Related Structures Protein Identity & Related Structures

Transthyretin

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6gnw__assembly_1__model_1

6gnw__assembly_1__model_1 | I(q)

6gnw__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 4 domains

SCOP 2.08 (4 domains)

7. Citations (2)