SAXSdb — 6hil

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Transcriptional enhancer factor TEF-1

Homo sapiens

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	Transcriptional coactivator YAP1 × 1 （P46937） MYRISTIC ACID × 1 water × 2	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 2	Transcriptional coactivator YAP1 × 1 （P46937） MYRISTIC ACID × 1 water × 2	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 2	Transcriptional coactivator YAP1 × 1 （P46937） MYRISTIC ACID × 1 water × 2	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 2	Transcriptional coactivator YAP1 × 1 （P46937） MYRISTIC ACID × 1 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TEAD1_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–218； UniProt 208–425 Author chain B； PDBConstruct 1–218； UniProt 208–425 Author chain C； PDBConstruct 1–218； UniProt 208–425 Author chain D； PDBConstruct 1–218； UniProt 208–425

Transcriptional coactivator YAP1

OrganismNot specified

UniProt P46937

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	Transcriptional enhancer factor TEF-1 × 1 （P28347） MYRISTIC ACID × 1 water × 2	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 2	Transcriptional enhancer factor TEF-1 × 1 （P28347） MYRISTIC ACID × 1 water × 2	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 2	Transcriptional enhancer factor TEF-1 × 1 （P28347） MYRISTIC ACID × 1 water × 2	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 2	Transcriptional enhancer factor TEF-1 × 1 （P28347） MYRISTIC ACID × 1 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	YAP1_HUMAN
Isoform	P46937-9
PDB entities	2
Chains and sequence ranges	Author chain L； PDBConstruct 1–41； UniProt 60–100 Author chain M； PDBConstruct 1–41； UniProt 60–100 Author chain N； PDBConstruct 1–41； UniProt 60–100 Author chain O； PDBConstruct 1–41； UniProt 60–100

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6hil
Deposition date deposition_date	2018-08-30
Structure title title	X-ray structure of TEAD1(Y421H mutant) complexed with YAP(wildtype): Molecular and structural characterization of a TEAD mutation at the origin of Sveinsson's chorioretinal atrophy
Keywords keywords	OTHER, TRANSCRIPTION FACTOR, TRANSCRIPTION; TRANSCRIPTION
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6hil__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6hil__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6hil__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	19.84 Å
Rg (electron density)	18.34 Å
Total Rg	19.31 Å
Atom count	1940
Residues	237
Excluded volume	34843 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6hil__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`6hil__assembly_2__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`6hil__assembly_3__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
4	1	`6hil__assembly_4__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	Transcriptional enhancer factor TEF-1
Molecular weight formula_weight	25223.7 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,D,B,C
Atom count atom_count	8002

GRSIGTTKLRLVEFSAFLEQQRDPDSYNKHLFVHIGHANHSYSDPLLESVDIRQIYDKFPEKKGGLKELFGKGPQNAFFLVKFWADLNCNIQDDAGAFYGVTSQYESSENMTVTCSTKVCSFGKQVVEKVETEYARFENGRFVYRINRSPMCEYMINFIHKLKHLPEKYMMNSVLENFTILLVVTNRDTQETLLCMACVFEVSNSEHGAQHHIHRLVK

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 2 Entity 2 polymer

Description description	Transcriptional coactivator YAP1
Molecular weight formula_weight	4650.3 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L,O,M,N

DSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPE

Entity 3 Entity 3 non-polymer

Description description	MYRISTIC ACID
Molecular weight formula_weight	228.4 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	140

▼

6. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (4 domains)

Domain ID domain_id	d6hila_
Class class	b — All beta proteins
Fold Fold fold	b.1 — Immunoglobulin-like beta-sandwich
Superfamily Superfamily superfamily	b.1.18 — E set domains
Family Family family	b.1.18.26 — TEAD-like transcription factors, E-set domain

Domain ID domain_id	d6hilb_
Class class	b — All beta proteins
Fold Fold fold	b.1 — Immunoglobulin-like beta-sandwich
Superfamily Superfamily superfamily	b.1.18 — E set domains
Family Family family	b.1.18.26 — TEAD-like transcription factors, E-set domain

Domain ID domain_id	d6hilc_
Class class	b — All beta proteins
Fold Fold fold	b.1 — Immunoglobulin-like beta-sandwich
Superfamily Superfamily superfamily	b.1.18 — E set domains
Family Family family	b.1.18.26 — TEAD-like transcription factors, E-set domain

Domain ID domain_id	d6hild_
Class class	b — All beta proteins
Fold Fold fold	b.1 — Immunoglobulin-like beta-sandwich
Superfamily Superfamily superfamily	b.1.18 — E set domains
Family Family family	b.1.18.26 — TEAD-like transcription factors, E-set domain

CATH v4.4 (4 domains)

Domain ID domain_id	6hilA00
Class class	2 — Mainly Beta
Architecture architecture	70 — Distorted Sandwich
Topology topology	50 — Coagulation Factor XIII; Chain A, domain 1
Homologous superfamily homologous superfamily	80 —

Domain ID domain_id	6hilB00
Class class	2 — Mainly Beta
Architecture architecture	70 — Distorted Sandwich
Topology topology	50 — Coagulation Factor XIII; Chain A, domain 1
Homologous superfamily homologous superfamily	80 —

Domain ID domain_id	6hilC00
Class class	2 — Mainly Beta
Architecture architecture	70 — Distorted Sandwich
Topology topology	50 — Coagulation Factor XIII; Chain A, domain 1
Homologous superfamily homologous superfamily	80 —

Domain ID domain_id	6hilD00
Class class	2 — Mainly Beta
Architecture architecture	70 — Distorted Sandwich
Topology topology	50 — Coagulation Factor XIII; Chain A, domain 1
Homologous superfamily homologous superfamily	80 —

▶

Unit-cell length a length_a	40.125 Å
Unit-cell length b length_b	46.544 Å
Unit-cell length c length_c	144.337 Å
Unit-cell angle α angle_alpha	98.61 °
Unit-cell angle β angle_beta	90.85 °
Unit-cell angle γ angle_gamma	108.14 °
Molecules per unit cell Z z_pdb	4

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	2.300 Å
Low-resolution limit resolution_low	19.900 Å
R factor r_factor	0.2437
R_work r_work	0.2425
R_free r_free	0.2674

X-ray structure of TEAD1(Y421H mutant) complexed with YAP(wildtype): Molecular and structural characterization of a TEAD mutation at the origin of Sveinsson's chorioretinal atrophy

1. Protein Identity and Related Structures Protein Identity & Related Structures

Transcriptional enhancer factor TEF-1

State in the Current Structure

Other States of the Same Protein in the Database

Transcriptional coactivator YAP1

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6hil__assembly_1__model_1

6hil__assembly_1__model_1 | I(q)

6hil__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (4 domains)

CATH v4.4 (4 domains)

7. Citations (1)

X-ray structure of TEAD1(Y421H mutant) complexed with YAP(wildtype): Molecular and structural characterization of a TEAD mutation at the origin of Sveinsson's chorioretinal atrophy

1. Protein Identity and Related Structures Protein Identity & Related Structures

Transcriptional enhancer factor TEF-1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Transcriptional coactivator YAP1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6hil__assembly_1__model_1

6hil__assembly_1__model_1 | I(q)

6hil__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (4 domains)

CATH v4.4 (4 domains)

7. Citations (1)