6ibo

Catalytic deficiency of O-GlcNAc transferase leads to X-linked intellectual disability

Method: X-RAY DIFFRACTION D_max: 95.7 Å Quality: GOOD

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit

Homo sapiens

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain A； UniProt 323–1041	Not recorded	ALA-VAL-SER-ARG-ALA × 1 12V (2S,3R,4R,5S,6R)-3-(acetylamino)-4,5-dihydroxy-6-(hydroxymethyl)tetrahydro-2H-thiopyran-2-yl [(2R,3S,4R,5R)-5-(2,4-dioxo-3,4-dihydropyrimidin-1(2H)-yl)-3,4-dihydroxytetrahydrofuran-2-yl]methyl dihydrogen diphosphate × 1 PO4 PHOSPHATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 7.5；293 K；1.45 M K2HPO4, 8 mM EDTA and 1% xylitol	Resolution 2.17 Å R-free 0.254

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 6IBO	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1W3B The superhelical TPR domain of O-linked GlcNAc transferase reveals structural similarities to importin alpha. Deposited 2004-07-14	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 16–400（385 aa） Fragment：TPR DOMAIN, RESIDUES 16-400 Chain B 16–400（385 aa） Fragment：TPR DOMAIN, RESIDUES 16-400	Not recorded	CA CALCIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.5；0.1M HEPES-NA/HCL PH 7.5 0.2M CACL2 36% PEG 400	Resolution 2.85 Å R-free 0.297
3PE3 Structure of human O-GlcNAc transferase and its complex with a peptide substrate Deposited 2010-10-25	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 323–1041（719 aa） Fragment：hOGT4.5, UNP residues 323-1041	Not recorded	UDP URIDINE-5'-DIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；298 K；1.45 M Potassium Phosphate Dibasic, 8 mM EDTA, 1% xylitol, pH 8.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.78 Å R-free 0.218
3PE3 Structure of human O-GlcNAc transferase and its complex with a peptide substrate Deposited 2010-10-25	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 323–1041（719 aa） Fragment：hOGT4.5, UNP residues 323-1041	Not recorded	UDP URIDINE-5'-DIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；298 K；1.45 M Potassium Phosphate Dibasic, 8 mM EDTA, 1% xylitol, pH 8.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.78 Å R-free 0.218
3PE3 Structure of human O-GlcNAc transferase and its complex with a peptide substrate Deposited 2010-10-25	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain C 323–1041（719 aa） Fragment：hOGT4.5, UNP residues 323-1041	Not recorded	UDP URIDINE-5'-DIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；298 K；1.45 M Potassium Phosphate Dibasic, 8 mM EDTA, 1% xylitol, pH 8.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.78 Å R-free 0.218
3PE3 Structure of human O-GlcNAc transferase and its complex with a peptide substrate Deposited 2010-10-25	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain D 323–1041（719 aa） Fragment：hOGT4.5, UNP residues 323-1041	Not recorded	UDP URIDINE-5'-DIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；298 K；1.45 M Potassium Phosphate Dibasic, 8 mM EDTA, 1% xylitol, pH 8.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.78 Å R-free 0.218
3PE4 Structure of human O-GlcNAc transferase and its complex with a peptide substrate Deposited 2010-10-25	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 323–1041（719 aa） Fragment：hOGT4.5, UNP residues 323-1041	Not recorded	UDP URIDINE-5'-DIPHOSPHATE × 1 SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；298 K；1.6M Lithium Sulfate, 0.1M Bis Tris Propane pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.95 Å R-free 0.252
3PE4 Structure of human O-GlcNAc transferase and its complex with a peptide substrate Deposited 2010-10-25	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 323–1041（719 aa） Fragment：hOGT4.5, UNP residues 323-1041	Not recorded	UDP URIDINE-5'-DIPHOSPHATE × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；298 K；1.6M Lithium Sulfate, 0.1M Bis Tris Propane pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.95 Å R-free 0.252
3PE4 Structure of human O-GlcNAc transferase and its complex with a peptide substrate Deposited 2010-10-25	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 323–1041（719 aa） Fragment：hOGT4.5, UNP residues 323-1041	Not recorded	UDP URIDINE-5'-DIPHOSPHATE × 2 SO4 SULFATE ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；298 K；1.6M Lithium Sulfate, 0.1M Bis Tris Propane pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.95 Å R-free 0.252
3PE4 Structure of human O-GlcNAc transferase and its complex with a peptide substrate Deposited 2010-10-25	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain C 323–1041（719 aa） Fragment：hOGT4.5, UNP residues 323-1041	Not recorded	UDP URIDINE-5'-DIPHOSPHATE × 2 SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；298 K；1.6M Lithium Sulfate, 0.1M Bis Tris Propane pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.95 Å R-free 0.252
3TAX A Neutral Diphosphate Mimic Crosslinks the Active Site of Human O-GlcNAc Transferase Deposited 2011-08-04	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 323–1041（719 aa） Fragment：UNP residues 323-1041	Not recorded	UDP URIDINE-5'-DIPHOSPHATE × 2 FOR FORMYL GROUP × 2 SO4 SULFATE ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；298 K；1.6M Lithium Sulfate, 0.1M Bis Tris Propane pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 298.0K	Resolution 1.88 Å R-free 0.237
3TAX A Neutral Diphosphate Mimic Crosslinks the Active Site of Human O-GlcNAc Transferase Deposited 2011-08-04	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 323–1041（719 aa） Fragment：UNP residues 323-1041	Not recorded	UDP URIDINE-5'-DIPHOSPHATE × 1 FOR FORMYL GROUP × 1 SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；298 K；1.6M Lithium Sulfate, 0.1M Bis Tris Propane pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 298.0K	Resolution 1.88 Å R-free 0.237
3TAX A Neutral Diphosphate Mimic Crosslinks the Active Site of Human O-GlcNAc Transferase Deposited 2011-08-04	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain C 323–1041（719 aa） Fragment：UNP residues 323-1041	Not recorded	UDP URIDINE-5'-DIPHOSPHATE × 2 FOR FORMYL GROUP × 2 SO4 SULFATE ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；298 K；1.6M Lithium Sulfate, 0.1M Bis Tris Propane pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 298.0K	Resolution 1.88 Å R-free 0.237
3TAX A Neutral Diphosphate Mimic Crosslinks the Active Site of Human O-GlcNAc Transferase Deposited 2011-08-04	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 323–1041（719 aa） Fragment：UNP residues 323-1041	Not recorded	UDP URIDINE-5'-DIPHOSPHATE × 1 FOR FORMYL GROUP × 1 SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；298 K；1.6M Lithium Sulfate, 0.1M Bis Tris Propane pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 298.0K	Resolution 1.88 Å R-free 0.237
4AY5 Human O-GlcNAc transferase (OGT) in complex with UDP and glycopeptide Deposited 2012-06-18	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 313–1031（719 aa） Fragment：TPR (TRUNCATED) AND CATALYTIC DOMAIN, RESIDUES 313-1031	Not recorded	UDP URIDINE-5'-DIPHOSPHATE × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 9.3；1.45 M K2HPO4, 10 MM EDTA, 1% XYLITOL, pH 9.3	Resolution 3.15 Å R-free 0.204
4AY5 Human O-GlcNAc transferase (OGT) in complex with UDP and glycopeptide Deposited 2012-06-18	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 313–1031（719 aa） Fragment：TPR (TRUNCATED) AND CATALYTIC DOMAIN, RESIDUES 313-1031	Not recorded	UDP URIDINE-5'-DIPHOSPHATE × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 9.3；1.45 M K2HPO4, 10 MM EDTA, 1% XYLITOL, pH 9.3	Resolution 3.15 Å R-free 0.204
4AY5 Human O-GlcNAc transferase (OGT) in complex with UDP and glycopeptide Deposited 2012-06-18	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 313–1031（719 aa） Fragment：TPR (TRUNCATED) AND CATALYTIC DOMAIN, RESIDUES 313-1031	Not recorded	UDP URIDINE-5'-DIPHOSPHATE × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 9.3；1.45 M K2HPO4, 10 MM EDTA, 1% XYLITOL, pH 9.3	Resolution 3.15 Å R-free 0.204
4AY5 Human O-GlcNAc transferase (OGT) in complex with UDP and glycopeptide Deposited 2012-06-18	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 313–1031（719 aa） Fragment：TPR (TRUNCATED) AND CATALYTIC DOMAIN, RESIDUES 313-1031	Not recorded	UDP URIDINE-5'-DIPHOSPHATE × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 9.3；1.45 M K2HPO4, 10 MM EDTA, 1% XYLITOL, pH 9.3	Resolution 3.15 Å R-free 0.204
4AY6 Human O-GlcNAc transferase (OGT) in complex with UDP-5SGlcNAc and substrate peptide Deposited 2012-06-18	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 197–915（719 aa） Fragment：TPR (TRUNCATED) AND CATALYTIC DOMAIN, RESIDUES 197-915	Not recorded	SO4 SULFATE ION × 1 12V (2S,3R,4R,5S,6R)-3-(acetylamino)-4,5-dihydroxy-6-(hydroxymethyl)tetrahydro-2H-thiopyran-2-yl [(2R,3S,4R,5R)-5-(2,4-dioxo-3,4-dihydropyrimidin-1(2H)-yl)-3,4-dihydroxytetrahydrofuran-2-yl]methyl dihydrogen diphosphate × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 9.3；1.45 M K2HPO4, 10 MM EDTA, 1 % XYLITOL, pH 9.3	Resolution 3.30 Å R-free 0.272
4AY6 Human O-GlcNAc transferase (OGT) in complex with UDP-5SGlcNAc and substrate peptide Deposited 2012-06-18	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 197–915（719 aa） Fragment：TPR (TRUNCATED) AND CATALYTIC DOMAIN, RESIDUES 197-915	Not recorded	SO4 SULFATE ION × 1 12V (2S,3R,4R,5S,6R)-3-(acetylamino)-4,5-dihydroxy-6-(hydroxymethyl)tetrahydro-2H-thiopyran-2-yl [(2R,3S,4R,5R)-5-(2,4-dioxo-3,4-dihydropyrimidin-1(2H)-yl)-3,4-dihydroxytetrahydrofuran-2-yl]methyl dihydrogen diphosphate × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 9.3；1.45 M K2HPO4, 10 MM EDTA, 1 % XYLITOL, pH 9.3	Resolution 3.30 Å R-free 0.272
4AY6 Human O-GlcNAc transferase (OGT) in complex with UDP-5SGlcNAc and substrate peptide Deposited 2012-06-18	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 197–915（719 aa） Fragment：TPR (TRUNCATED) AND CATALYTIC DOMAIN, RESIDUES 197-915	Not recorded	SO4 SULFATE ION × 1 12V (2S,3R,4R,5S,6R)-3-(acetylamino)-4,5-dihydroxy-6-(hydroxymethyl)tetrahydro-2H-thiopyran-2-yl [(2R,3S,4R,5R)-5-(2,4-dioxo-3,4-dihydropyrimidin-1(2H)-yl)-3,4-dihydroxytetrahydrofuran-2-yl]methyl dihydrogen diphosphate × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 9.3；1.45 M K2HPO4, 10 MM EDTA, 1 % XYLITOL, pH 9.3	Resolution 3.30 Å R-free 0.272
4AY6 Human O-GlcNAc transferase (OGT) in complex with UDP-5SGlcNAc and substrate peptide Deposited 2012-06-18	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 197–915（719 aa） Fragment：TPR (TRUNCATED) AND CATALYTIC DOMAIN, RESIDUES 197-915	Not recorded	SO4 SULFATE ION × 1 12V (2S,3R,4R,5S,6R)-3-(acetylamino)-4,5-dihydroxy-6-(hydroxymethyl)tetrahydro-2H-thiopyran-2-yl [(2R,3S,4R,5R)-5-(2,4-dioxo-3,4-dihydropyrimidin-1(2H)-yl)-3,4-dihydroxytetrahydrofuran-2-yl]methyl dihydrogen diphosphate × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 9.3；1.45 M K2HPO4, 10 MM EDTA, 1 % XYLITOL, pH 9.3	Resolution 3.30 Å R-free 0.272
4CDR Human O-GlcNAc transferase in complex with a bisubstrate inhibitor, Goblin1 Deposited 2013-11-05	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 323–1041（719 aa） Fragment：TPR AND CATALYTIC DOMAIN, RESIDUES 323-1041	Not recorded	SO4 SULFATE ION × 8 UDP URIDINE-5'-DIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 9.3；1.45 M K2HPO4, 10 MM EDTA, 1% XYLITOL, pH 9.3	Resolution 3.15 Å R-free 0.213
4CDR Human O-GlcNAc transferase in complex with a bisubstrate inhibitor, Goblin1 Deposited 2013-11-05	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 323–1041（719 aa） Fragment：TPR AND CATALYTIC DOMAIN, RESIDUES 323-1041	Not recorded	SO4 SULFATE ION × 6 UDP URIDINE-5'-DIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 9.3；1.45 M K2HPO4, 10 MM EDTA, 1% XYLITOL, pH 9.3	Resolution 3.15 Å R-free 0.213
4CDR Human O-GlcNAc transferase in complex with a bisubstrate inhibitor, Goblin1 Deposited 2013-11-05	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 323–1041（719 aa） Fragment：TPR AND CATALYTIC DOMAIN, RESIDUES 323-1041	Not recorded	SO4 SULFATE ION × 8 UDP URIDINE-5'-DIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 9.3；1.45 M K2HPO4, 10 MM EDTA, 1% XYLITOL, pH 9.3	Resolution 3.15 Å R-free 0.213
4CDR Human O-GlcNAc transferase in complex with a bisubstrate inhibitor, Goblin1 Deposited 2013-11-05	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 323–1041（719 aa） Fragment：TPR AND CATALYTIC DOMAIN, RESIDUES 323-1041	Not recorded	SO4 SULFATE ION × 9 UDP URIDINE-5'-DIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 9.3；1.45 M K2HPO4, 10 MM EDTA, 1% XYLITOL, pH 9.3	Resolution 3.15 Å R-free 0.213
4GYW Crystal structure of human O-GlcNAc Transferase in complex with UDP and a glycopeptide Deposited 2012-09-05	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 323–1041（719 aa）	Not recorded	UDP URIDINE-5'-DIPHOSPHATE × 1 SO4 SULFATE ION × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；298 K；1.6M Lithium Sulfate, 0.1M Bis Tris Propane pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.70 Å R-free 0.205
4GYW Crystal structure of human O-GlcNAc Transferase in complex with UDP and a glycopeptide Deposited 2012-09-05	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 323–1041（719 aa）	Not recorded	UDP URIDINE-5'-DIPHOSPHATE × 1 SO4 SULFATE ION × 2 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；298 K；1.6M Lithium Sulfate, 0.1M Bis Tris Propane pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.70 Å R-free 0.205
4GYW Crystal structure of human O-GlcNAc Transferase in complex with UDP and a glycopeptide Deposited 2012-09-05	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain C 323–1041（719 aa）	Not recorded	UDP URIDINE-5'-DIPHOSPHATE × 2 SO4 SULFATE ION × 2 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；298 K；1.6M Lithium Sulfate, 0.1M Bis Tris Propane pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.70 Å R-free 0.205
4GYW Crystal structure of human O-GlcNAc Transferase in complex with UDP and a glycopeptide Deposited 2012-09-05	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 323–1041（719 aa）	Not recorded	UDP URIDINE-5'-DIPHOSPHATE × 2 SO4 SULFATE ION × 4 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；298 K；1.6M Lithium Sulfate, 0.1M Bis Tris Propane pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.70 Å R-free 0.205
4GYY Crystal structure of human O-GlcNAc Transferase with UDP-5SGlcNAc and a peptide substrate Deposited 2012-09-05	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 323–1041（719 aa）	Not recorded	12V (2S,3R,4R,5S,6R)-3-(acetylamino)-4,5-dihydroxy-6-(hydroxymethyl)tetrahydro-2H-thiopyran-2-yl [(2R,3S,4R,5R)-5-(2,4-dioxo-3,4-dihydropyrimidin-1(2H)-yl)-3,4-dihydroxytetrahydrofuran-2-yl]methyl dihydrogen diphosphate × 1 SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；298 K；1.6M Lithium Sulfate, 0.1M Bis Tris Propane pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.85 Å R-free 0.237
4GYY Crystal structure of human O-GlcNAc Transferase with UDP-5SGlcNAc and a peptide substrate Deposited 2012-09-05	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 323–1041（719 aa）	Not recorded	12V (2S,3R,4R,5S,6R)-3-(acetylamino)-4,5-dihydroxy-6-(hydroxymethyl)tetrahydro-2H-thiopyran-2-yl [(2R,3S,4R,5R)-5-(2,4-dioxo-3,4-dihydropyrimidin-1(2H)-yl)-3,4-dihydroxytetrahydrofuran-2-yl]methyl dihydrogen diphosphate × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；298 K；1.6M Lithium Sulfate, 0.1M Bis Tris Propane pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.85 Å R-free 0.237
4GYY Crystal structure of human O-GlcNAc Transferase with UDP-5SGlcNAc and a peptide substrate Deposited 2012-09-05	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 323–1041（719 aa）	Not recorded	12V (2S,3R,4R,5S,6R)-3-(acetylamino)-4,5-dihydroxy-6-(hydroxymethyl)tetrahydro-2H-thiopyran-2-yl [(2R,3S,4R,5R)-5-(2,4-dioxo-3,4-dihydropyrimidin-1(2H)-yl)-3,4-dihydroxytetrahydrofuran-2-yl]methyl dihydrogen diphosphate × 2 SO4 SULFATE ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；298 K；1.6M Lithium Sulfate, 0.1M Bis Tris Propane pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.85 Å R-free 0.237
4GYY Crystal structure of human O-GlcNAc Transferase with UDP-5SGlcNAc and a peptide substrate Deposited 2012-09-05	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain C 323–1041（719 aa）	Not recorded	12V (2S,3R,4R,5S,6R)-3-(acetylamino)-4,5-dihydroxy-6-(hydroxymethyl)tetrahydro-2H-thiopyran-2-yl [(2R,3S,4R,5R)-5-(2,4-dioxo-3,4-dihydropyrimidin-1(2H)-yl)-3,4-dihydroxytetrahydrofuran-2-yl]methyl dihydrogen diphosphate × 2 SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；298 K；1.6M Lithium Sulfate, 0.1M Bis Tris Propane pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.85 Å R-free 0.237
4GZ3 Crystal structure of human O-GlcNAc Transferase with UDP and a thioglycopeptide Deposited 2012-09-05	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 323–1041（719 aa）	Not recorded	UDP URIDINE-5'-DIPHOSPHATE × 1 SO4 SULFATE ION × 2 0YT 2-acetamido-2-deoxy-5-thio-beta-D-glucopyranose × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；298 K；1.6M Lithium Sulfate, 0.1M Bis Tris Propane pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.90 Å R-free 0.250
4GZ3 Crystal structure of human O-GlcNAc Transferase with UDP and a thioglycopeptide Deposited 2012-09-05	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 323–1041（719 aa）	Not recorded	UDP URIDINE-5'-DIPHOSPHATE × 1 SO4 SULFATE ION × 1 0YT 2-acetamido-2-deoxy-5-thio-beta-D-glucopyranose × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；298 K；1.6M Lithium Sulfate, 0.1M Bis Tris Propane pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.90 Å R-free 0.250
4GZ3 Crystal structure of human O-GlcNAc Transferase with UDP and a thioglycopeptide Deposited 2012-09-05	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 323–1041（719 aa）	Not recorded	UDP URIDINE-5'-DIPHOSPHATE × 2 SO4 SULFATE ION × 4 0YT 2-acetamido-2-deoxy-5-thio-beta-D-glucopyranose × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；298 K；1.6M Lithium Sulfate, 0.1M Bis Tris Propane pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.90 Å R-free 0.250
4GZ3 Crystal structure of human O-GlcNAc Transferase with UDP and a thioglycopeptide Deposited 2012-09-05	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain C 323–1041（719 aa）	Not recorded	UDP URIDINE-5'-DIPHOSPHATE × 2 SO4 SULFATE ION × 2 0YT 2-acetamido-2-deoxy-5-thio-beta-D-glucopyranose × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；298 K；1.6M Lithium Sulfate, 0.1M Bis Tris Propane pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.90 Å R-free 0.250
4GZ5 Crystal structure of human O-GlcNAc Transferase with UDP-GlcNAc Deposited 2012-09-06	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 323–1041（719 aa）	Not recorded	UD1 URIDINE-DIPHOSPHATE-N-ACETYLGLUCOSAMINE × 1 SO4 SULFATE ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；298 K；1.9M Ammonium Sulfate, 0.1M Tris pH 8.5, 1% Xylitol, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 3.08 Å R-free 0.229
4GZ5 Crystal structure of human O-GlcNAc Transferase with UDP-GlcNAc Deposited 2012-09-06	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 323–1041（719 aa）	Not recorded	UD1 URIDINE-DIPHOSPHATE-N-ACETYLGLUCOSAMINE × 1 SO4 SULFATE ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；298 K；1.9M Ammonium Sulfate, 0.1M Tris pH 8.5, 1% Xylitol, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 3.08 Å R-free 0.229
4GZ5 Crystal structure of human O-GlcNAc Transferase with UDP-GlcNAc Deposited 2012-09-06	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain C 323–1041（719 aa）	Not recorded	UD1 URIDINE-DIPHOSPHATE-N-ACETYLGLUCOSAMINE × 1 SO4 SULFATE ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；298 K；1.9M Ammonium Sulfate, 0.1M Tris pH 8.5, 1% Xylitol, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 3.08 Å R-free 0.229
4GZ5 Crystal structure of human O-GlcNAc Transferase with UDP-GlcNAc Deposited 2012-09-06	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain D 323–1041（719 aa）	Not recorded	UD1 URIDINE-DIPHOSPHATE-N-ACETYLGLUCOSAMINE × 1 SO4 SULFATE ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；298 K；1.9M Ammonium Sulfate, 0.1M Tris pH 8.5, 1% Xylitol, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 3.08 Å R-free 0.229
4GZ5 Crystal structure of human O-GlcNAc Transferase with UDP-GlcNAc Deposited 2012-09-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 5 Protein homooligomer Homooligomer；Protein × 12 PDB declaration: dodecameric	Chain A 323–1041（719 aa） Chain B 323–1041（719 aa） Chain C 323–1041（719 aa） Chain D 323–1041（719 aa）	Not recorded	UD1 URIDINE-DIPHOSPHATE-N-ACETYLGLUCOSAMINE × 12 SO4 SULFATE ION × 48	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；298 K；1.9M Ammonium Sulfate, 0.1M Tris pH 8.5, 1% Xylitol, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 3.08 Å R-free 0.229
4GZ6 Crystal structure of human O-GlcNAc Transferase with UDP-5SGlcNAc Deposited 2012-09-06	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 323–1041（719 aa）	Not recorded	12V (2S,3R,4R,5S,6R)-3-(acetylamino)-4,5-dihydroxy-6-(hydroxymethyl)tetrahydro-2H-thiopyran-2-yl [(2R,3S,4R,5R)-5-(2,4-dioxo-3,4-dihydropyrimidin-1(2H)-yl)-3,4-dihydroxytetrahydrofuran-2-yl]methyl dihydrogen diphosphate × 1 SO4 SULFATE ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；298 K；1.9M Ammonium Sulfate, 0.1M Tris pH 8.5, 1% Xylitol, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.98 Å R-free 0.223
4GZ6 Crystal structure of human O-GlcNAc Transferase with UDP-5SGlcNAc Deposited 2012-09-06	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 323–1041（719 aa）	Not recorded	12V (2S,3R,4R,5S,6R)-3-(acetylamino)-4,5-dihydroxy-6-(hydroxymethyl)tetrahydro-2H-thiopyran-2-yl [(2R,3S,4R,5R)-5-(2,4-dioxo-3,4-dihydropyrimidin-1(2H)-yl)-3,4-dihydroxytetrahydrofuran-2-yl]methyl dihydrogen diphosphate × 1 SO4 SULFATE ION × 5	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；298 K；1.9M Ammonium Sulfate, 0.1M Tris pH 8.5, 1% Xylitol, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.98 Å R-free 0.223
4GZ6 Crystal structure of human O-GlcNAc Transferase with UDP-5SGlcNAc Deposited 2012-09-06	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain C 323–1041（719 aa）	Not recorded	12V (2S,3R,4R,5S,6R)-3-(acetylamino)-4,5-dihydroxy-6-(hydroxymethyl)tetrahydro-2H-thiopyran-2-yl [(2R,3S,4R,5R)-5-(2,4-dioxo-3,4-dihydropyrimidin-1(2H)-yl)-3,4-dihydroxytetrahydrofuran-2-yl]methyl dihydrogen diphosphate × 1 SO4 SULFATE ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；298 K；1.9M Ammonium Sulfate, 0.1M Tris pH 8.5, 1% Xylitol, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.98 Å R-free 0.223
4GZ6 Crystal structure of human O-GlcNAc Transferase with UDP-5SGlcNAc Deposited 2012-09-06	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain D 323–1041（719 aa）	Not recorded	12V (2S,3R,4R,5S,6R)-3-(acetylamino)-4,5-dihydroxy-6-(hydroxymethyl)tetrahydro-2H-thiopyran-2-yl [(2R,3S,4R,5R)-5-(2,4-dioxo-3,4-dihydropyrimidin-1(2H)-yl)-3,4-dihydroxytetrahydrofuran-2-yl]methyl dihydrogen diphosphate × 1 SO4 SULFATE ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；298 K；1.9M Ammonium Sulfate, 0.1M Tris pH 8.5, 1% Xylitol, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.98 Å R-free 0.223
4GZ6 Crystal structure of human O-GlcNAc Transferase with UDP-5SGlcNAc Deposited 2012-09-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 5 Protein homooligomer Homooligomer；Protein × 12 PDB declaration: dodecameric	Chain A 323–1041（719 aa） Chain B 323–1041（719 aa） Chain C 323–1041（719 aa） Chain D 323–1041（719 aa）	Not recorded	12V (2S,3R,4R,5S,6R)-3-(acetylamino)-4,5-dihydroxy-6-(hydroxymethyl)tetrahydro-2H-thiopyran-2-yl [(2R,3S,4R,5R)-5-(2,4-dioxo-3,4-dihydropyrimidin-1(2H)-yl)-3,4-dihydroxytetrahydrofuran-2-yl]methyl dihydrogen diphosphate × 12 SO4 SULFATE ION × 51	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；298 K；1.9M Ammonium Sulfate, 0.1M Tris pH 8.5, 1% Xylitol, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.98 Å R-free 0.223
4N39 Crystal structure of human O-GlcNAc transferase bound to a peptide from HCF-1 pro-repeat 2 (11-26) Deposited 2013-10-06	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 323–1041（719 aa） Fragment：UNP residues 323-1041	Not recorded	UDP URIDINE-5'-DIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；298 K；1.5 M Potassium Sodium Tartrate, 0.1M Tris, pH 8.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.76 Å R-free 0.216
4N3A Crystal Structure of human O-GlcNAc transferase bound to a peptide from HCF-1 pro-repeat 2 (1-26)E10A Deposited 2013-10-06	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 323–1041（719 aa） Fragment：UNP residues 323-1041	Not recorded	UDP URIDINE-5'-DIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；298 K；0.72M Potassium Phosphate Monobasic, 0.88M Potassium Phosphate Dibasic, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.88 Å R-free 0.222
4N3B Crystal Structure of human O-GlcNAc Transferase bound to a peptide from HCF-1 pro-repeat2(1-26)E10Q and UDP-5SGlcNAc Deposited 2013-10-06	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 323–1041（719 aa） Fragment：UNP residues 323-1041	Not recorded	12V (2S,3R,4R,5S,6R)-3-(acetylamino)-4,5-dihydroxy-6-(hydroxymethyl)tetrahydro-2H-thiopyran-2-yl [(2R,3S,4R,5R)-5-(2,4-dioxo-3,4-dihydropyrimidin-1(2H)-yl)-3,4-dihydroxytetrahydrofuran-2-yl]methyl dihydrogen diphosphate × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；298 K；1.4M Sodium Malonate, 0.1M Bis Tris Propane, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.17 Å R-free 0.223
4N3C Crystal Structure of human O-GlcNAc Transferase bound to a peptide from HCF-1 pro-repeat2(1-26) and UDP-GlcNAc Deposited 2013-10-06	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 323–1041（719 aa） Fragment：UNP residues 323-1041	Not recorded	UD1 URIDINE-DIPHOSPHATE-N-ACETYLGLUCOSAMINE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.8；298 K；0.86M Potassium Phosphate Dibasic, 0.86M Sodium Phosphate Monobasic, pH 6.8, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.55 Å R-free 0.226
4XI9 Human OGT in complex with UDP-5S-GlcNAc and substrate peptide (RBL2) Deposited 2015-01-06	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 323–1041（719 aa） Fragment：UNP residues 323-1041	Not recorded	12V (2S,3R,4R,5S,6R)-3-(acetylamino)-4,5-dihydroxy-6-(hydroxymethyl)tetrahydro-2H-thiopyran-2-yl [(2R,3S,4R,5R)-5-(2,4-dioxo-3,4-dihydropyrimidin-1(2H)-yl)-3,4-dihydroxytetrahydrofuran-2-yl]methyl dihydrogen diphosphate × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；1.45 M potassium phosphate, 10 mM EDTA, 1% (w/v) xylitol	Resolution 3.10 Å R-free 0.223
4XI9 Human OGT in complex with UDP-5S-GlcNAc and substrate peptide (RBL2) Deposited 2015-01-06	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 323–1041（719 aa） Fragment：UNP residues 323-1041	Not recorded	12V (2S,3R,4R,5S,6R)-3-(acetylamino)-4,5-dihydroxy-6-(hydroxymethyl)tetrahydro-2H-thiopyran-2-yl [(2R,3S,4R,5R)-5-(2,4-dioxo-3,4-dihydropyrimidin-1(2H)-yl)-3,4-dihydroxytetrahydrofuran-2-yl]methyl dihydrogen diphosphate × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；1.45 M potassium phosphate, 10 mM EDTA, 1% (w/v) xylitol	Resolution 3.10 Å R-free 0.223
4XI9 Human OGT in complex with UDP-5S-GlcNAc and substrate peptide (RBL2) Deposited 2015-01-06	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 323–1041（719 aa） Fragment：UNP residues 323-1041	Not recorded	12V (2S,3R,4R,5S,6R)-3-(acetylamino)-4,5-dihydroxy-6-(hydroxymethyl)tetrahydro-2H-thiopyran-2-yl [(2R,3S,4R,5R)-5-(2,4-dioxo-3,4-dihydropyrimidin-1(2H)-yl)-3,4-dihydroxytetrahydrofuran-2-yl]methyl dihydrogen diphosphate × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；1.45 M potassium phosphate, 10 mM EDTA, 1% (w/v) xylitol	Resolution 3.10 Å R-free 0.223
4XI9 Human OGT in complex with UDP-5S-GlcNAc and substrate peptide (RBL2) Deposited 2015-01-06	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 323–1041（719 aa） Fragment：UNP residues 323-1041	Not recorded	12V (2S,3R,4R,5S,6R)-3-(acetylamino)-4,5-dihydroxy-6-(hydroxymethyl)tetrahydro-2H-thiopyran-2-yl [(2R,3S,4R,5R)-5-(2,4-dioxo-3,4-dihydropyrimidin-1(2H)-yl)-3,4-dihydroxytetrahydrofuran-2-yl]methyl dihydrogen diphosphate × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；1.45 M potassium phosphate, 10 mM EDTA, 1% (w/v) xylitol	Resolution 3.10 Å R-free 0.223
4XIF Human OGT in complex with UDP-5S-GlcNAc and substrate peptide (keratin-7) Deposited 2015-01-06	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 323–1041（719 aa） Fragment：UNP residues 323-1041	Not recorded	SO4 SULFATE ION × 1 12V (2S,3R,4R,5S,6R)-3-(acetylamino)-4,5-dihydroxy-6-(hydroxymethyl)tetrahydro-2H-thiopyran-2-yl [(2R,3S,4R,5R)-5-(2,4-dioxo-3,4-dihydropyrimidin-1(2H)-yl)-3,4-dihydroxytetrahydrofuran-2-yl]methyl dihydrogen diphosphate × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；1.45 M potassium phosphate, 10 mM EDTA, 1% (w/v) xylitol	Resolution 3.20 Å R-free 0.239
4XIF Human OGT in complex with UDP-5S-GlcNAc and substrate peptide (keratin-7) Deposited 2015-01-06	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 323–1041（719 aa） Fragment：UNP residues 323-1041	Not recorded	SO4 SULFATE ION × 1 12V (2S,3R,4R,5S,6R)-3-(acetylamino)-4,5-dihydroxy-6-(hydroxymethyl)tetrahydro-2H-thiopyran-2-yl [(2R,3S,4R,5R)-5-(2,4-dioxo-3,4-dihydropyrimidin-1(2H)-yl)-3,4-dihydroxytetrahydrofuran-2-yl]methyl dihydrogen diphosphate × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；1.45 M potassium phosphate, 10 mM EDTA, 1% (w/v) xylitol	Resolution 3.20 Å R-free 0.239
4XIF Human OGT in complex with UDP-5S-GlcNAc and substrate peptide (keratin-7) Deposited 2015-01-06	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 323–1041（719 aa） Fragment：UNP residues 323-1041	Not recorded	SO4 SULFATE ION × 1 12V (2S,3R,4R,5S,6R)-3-(acetylamino)-4,5-dihydroxy-6-(hydroxymethyl)tetrahydro-2H-thiopyran-2-yl [(2R,3S,4R,5R)-5-(2,4-dioxo-3,4-dihydropyrimidin-1(2H)-yl)-3,4-dihydroxytetrahydrofuran-2-yl]methyl dihydrogen diphosphate × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；1.45 M potassium phosphate, 10 mM EDTA, 1% (w/v) xylitol	Resolution 3.20 Å R-free 0.239
4XIF Human OGT in complex with UDP-5S-GlcNAc and substrate peptide (keratin-7) Deposited 2015-01-06	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 323–1041（719 aa） Fragment：UNP residues 323-1041	Not recorded	SO4 SULFATE ION × 1 12V (2S,3R,4R,5S,6R)-3-(acetylamino)-4,5-dihydroxy-6-(hydroxymethyl)tetrahydro-2H-thiopyran-2-yl [(2R,3S,4R,5R)-5-(2,4-dioxo-3,4-dihydropyrimidin-1(2H)-yl)-3,4-dihydroxytetrahydrofuran-2-yl]methyl dihydrogen diphosphate × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；1.45 M potassium phosphate, 10 mM EDTA, 1% (w/v) xylitol	Resolution 3.20 Å R-free 0.239
5BNW The active site of O-GlcNAc transferase imposes constraints on substrate sequence Deposited 2015-05-26	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 197–915（719 aa） Fragment：UNP residues 197-915	Not recorded	12V (2S,3R,4R,5S,6R)-3-(acetylamino)-4,5-dihydroxy-6-(hydroxymethyl)tetrahydro-2H-thiopyran-2-yl [(2R,3S,4R,5R)-5-(2,4-dioxo-3,4-dihydropyrimidin-1(2H)-yl)-3,4-dihydroxytetrahydrofuran-2-yl]methyl dihydrogen diphosphate × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.4；294 K；1.3 M DL-Malic acid pH 6.4, 0.1 M Bis-Tris propane pH 6.4 supplemented with crystal seeds grown out of the same condition.	Resolution 2.40 Å R-free 0.235
5C1D Human OGT in complex with UDP-5S-GlcNAc and substrate peptide (RB2L) Deposited 2015-06-13	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 313–1031（719 aa） Fragment：UNP residues 313-1031	Not recorded	12V (2S,3R,4R,5S,6R)-3-(acetylamino)-4,5-dihydroxy-6-(hydroxymethyl)tetrahydro-2H-thiopyran-2-yl [(2R,3S,4R,5R)-5-(2,4-dioxo-3,4-dihydropyrimidin-1(2H)-yl)-3,4-dihydroxytetrahydrofuran-2-yl]methyl dihydrogen diphosphate × 1 PO4 PHOSPHATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.4；294.15 K；1.45 M Potassium diohydrogen phosphate, 8 mM EDTA, 1% xylitol (reservoir). 1.45 M Potassium diohydrogen phosphate, 8 mM EDTA, 1% xylitol, 0.5 M Ammonium sulfate (drop)	Resolution 2.05 Å R-free 0.229
5HGV Structure of an O-GlcNAc transferase point mutant, D554N in complex with peptide Deposited 2016-01-08	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 323–1041（719 aa）	Mutation：D554N	UDP URIDINE-5'-DIPHOSPHATE × 1 SO4 SULFATE ION × 2 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；298 K；1.6 M Lithium Sulfate, 0.1 M Bis Tris Propane pH 7.0	Resolution 2.05 Å R-free 0.237
5HGV Structure of an O-GlcNAc transferase point mutant, D554N in complex with peptide Deposited 2016-01-08	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 323–1041（719 aa）	Mutation：D554N	UDP URIDINE-5'-DIPHOSPHATE × 1 SO4 SULFATE ION × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；298 K；1.6 M Lithium Sulfate, 0.1 M Bis Tris Propane pH 7.0	Resolution 2.05 Å R-free 0.237
5HGV Structure of an O-GlcNAc transferase point mutant, D554N in complex with peptide Deposited 2016-01-08	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 323–1041（719 aa）	Mutation：D554N	UDP URIDINE-5'-DIPHOSPHATE × 2 SO4 SULFATE ION × 4 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；298 K；1.6 M Lithium Sulfate, 0.1 M Bis Tris Propane pH 7.0	Resolution 2.05 Å R-free 0.237
5HGV Structure of an O-GlcNAc transferase point mutant, D554N in complex with peptide Deposited 2016-01-08	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain C 323–1041（719 aa）	Mutation：D554N	UDP URIDINE-5'-DIPHOSPHATE × 2 SO4 SULFATE ION × 2 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；298 K；1.6 M Lithium Sulfate, 0.1 M Bis Tris Propane pH 7.0	Resolution 2.05 Å R-free 0.237
5LVV Human OGT in complex with UDP and fused substrate peptide (Tab1) Deposited 2016-09-14	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 199–920（722 aa）	Not recorded	UDP URIDINE-5'-DIPHOSPHATE × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；291 K；3.5M sodium formate, 0.1M Tris pH 8.5	Resolution 2.54 Å R-free 0.245
5LWV Human OGT in complex with UDP and fused substrate peptide (HCF1) Deposited 2016-09-19	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 315–1036（722 aa）	Not recorded	UDP URIDINE-5'-DIPHOSPHATE × 1 GOL GLYCEROL × 1 PO4 PHOSPHATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；291 K；1.3M Ammonium tartrate diabasic; 0.1M Tris pH8.5	Resolution 1.90 Å R-free 0.199
5NPR The human O-GlcNAc transferase in complex with a thiol-linked bisubstrate inhibitor Deposited 2017-04-18	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 325–1041（717 aa） Fragment：UNP residues 325-1041	Not recorded	K POTASSIUM ION × 1 94T [[(2~{R},3~{S},4~{R},5~{R})-5-[2,4-bis(oxidanylidene)pyrimidin-1-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl] propyl hydrogen phosphate × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.4；295 K；Reservoir solution: 1.45 M K2HPO4, 8 mM EDTA, 1% xylitol Drop solution: 1.45 M K2HPO4, 8 mM EDTA, 1% xylitol, 0.5 M (NH4)2SO4, crystal seeds Seeds were generated from crystals grown in 1.3 M DL-Malic acid, 0.1 M Bis-Tris propane pH 6.4	Resolution 1.85 Å R-free 0.236
5NPS The human O-GlcNAc transferase in complex with a bisubstrate inhibitor Deposited 2017-04-18	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 324–1041（718 aa）	Not recorded	94T [[(2~{R},3~{S},4~{R},5~{R})-5-[2,4-bis(oxidanylidene)pyrimidin-1-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl] propyl hydrogen phosphate × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.4；295 K；1.3 M DL-Malic acid, 0.1 M Bis-Tris propane pH 6.4 + seeds generated out of this condition	Resolution 1.68 Å R-free 0.221
5VIE Electrophilic probes for deciphering substrate recognition by O-GlcNAc transferase Deposited 2017-04-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 323–1041（719 aa） Fragment：UNP residues 323-1041 Chain C 323–1041（719 aa） Fragment：UNP residues 323-1041	Not recorded	UDP URIDINE-5'-DIPHOSPHATE × 2 9C1 2-{[(2E)-4-chlorobut-2-enoyl]amino}-2-deoxy-beta-D-glucopyranose × 1 9CD 2-{[(2E)-but-2-enoyl]amino}-2-deoxy-beta-D-glucopyranose × 1	X-RAY DIFFRACTION X-ray crystallization conditions EVAPORATION；293 K；0.08 M Tris (pH 8.5), 0.02 M sodium cacodylate trihydrate (pH 6.5), 1.24 M ammonium sulfate, and 6% w/v polyethylene glycol 8,000.	Resolution 2.60 Å R-free 0.308
5VIF Electrophilic probes for deciphering substrate recognition by O-GlcNAc transferase Deposited 2017-04-15	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 323–1041（719 aa） Fragment：UNP residues 323-1041	Not recorded	UDP URIDINE-5'-DIPHOSPHATE × 2 9C1 2-{[(2E)-4-chlorobut-2-enoyl]amino}-2-deoxy-beta-D-glucopyranose × 2	X-RAY DIFFRACTION X-ray crystallization conditions EVAPORATION；293 K；0.08 M BIS-TRIS propane (pH 7.0), 0.02 M sodium cacodylate trihydrate (pH 6.5), 2.8 M sodium formate, 0.04 M ammonium sulfate, and 6% w/v polyethylene glycol 8,000.	Resolution 2.25 Å R-free 0.228
6E37 O-GlcNAc Transferase in complex with covalent inhibitor Deposited 2018-07-13	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 197–915（719 aa）	Not recorded	HQV (2S,3R,4R,5S,6R)-3-[(2E)-but-2-enoylamino]-4,5-dihydroxy-6-(hydroxymethyl)tetrahydro-2H-thiopyran-2-yl [(2R,3S,4R,5R)-5-(2,4-dioxo-3,4-dihydropyrimidin-1(2H)-yl)-3,4-dihydroxytetrahydrofuran-2-yl]methyl dihydrogen diphosphate (non-preferred name) × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；293 K；1.45 M potassium phosphate dibasic 10 mM EDTA 1% xylitol	Resolution 2.53 Å R-free 0.211
6E37 O-GlcNAc Transferase in complex with covalent inhibitor Deposited 2018-07-13	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 197–915（719 aa）	Not recorded	HQV (2S,3R,4R,5S,6R)-3-[(2E)-but-2-enoylamino]-4,5-dihydroxy-6-(hydroxymethyl)tetrahydro-2H-thiopyran-2-yl [(2R,3S,4R,5R)-5-(2,4-dioxo-3,4-dihydropyrimidin-1(2H)-yl)-3,4-dihydroxytetrahydrofuran-2-yl]methyl dihydrogen diphosphate (non-preferred name) × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；293 K；1.45 M potassium phosphate dibasic 10 mM EDTA 1% xylitol	Resolution 2.53 Å R-free 0.211
6EOU O-GlcNAc transferase TPR domain with the intellectual disability associated mutation L254F Deposited 2017-10-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 26–410（385 aa）	Mutation：L254F	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；295.2 K；0.1 M Na-HEPES and 0.1 M MOPS-HCl pH 7,5, 0.04 M diethylene glycol, 0.04 M triethylene glycol, 0.04 M tetraethylene glycol, 0.04 M pentaethylene glycol, 20 % v/v ethylene glycol and 10 % w/v PEG 4000	Resolution 1.75 Å R-free 0.227
6MA1 Crystal structure of human O-GlcNAc transferase bound to a peptide from HCF-1 pro-repeat 2 (11-26) and inhibitor 4a Deposited 2018-08-25	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 197–915（719 aa）	Not recorded	JA4 N-[(2R)-2-{[(7-chloro-2-oxo-1,2-dihydroquinolin-6-yl)sulfonyl]amino}-2-(2-methoxyphenyl)acetyl]-N-[(thiophen-2-yl)methyl]glycine × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；298 K；1.1 M Sodium Citrate Tribasic Dihydrate, 0.1M Tris, pH 8.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.75 Å R-free 0.240
6MA2 Crystal structure of human O-GlcNAc transferase bound to a peptide from HCF-1 pro-repeat 2 (11-26) and inhibitor ent-1a Deposited 2018-08-25	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 197–915（719 aa）	Not recorded	J9S N-[(2S)-2-(2-methoxyphenyl)-2-{[(2-oxo-1,2-dihydroquinolin-6-yl)sulfonyl]amino}acetyl]-N-[(thiophen-2-yl)methyl]glycine × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；298 K；1.05 M Sodium Citrate Tribasic Dihydrate, 0.1M Tris, pH 8.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.10 Å R-free 0.218
6MA3 Crystal structure of human O-GlcNAc transferase bound to a peptide from HCF-1 pro-repeat 2 (11-26) and inhibitor 2a Deposited 2018-08-25	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 197–915（719 aa）	Not recorded	JAJ 4-{2-[(1R)-2-{(carboxymethyl)[(thiophen-2-yl)methyl]amino}-2-oxo-1-{[(2-oxo-1,2-dihydroquinolin-6-yl)sulfonyl]amino}ethyl]phenoxy}butanoic acid × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；298 K；1.05 M Sodium Citrate Tribasic Dihydrate, 0.1M Tris, pH 8.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.00 Å R-free 0.212
6MA4 Crystal structure of human O-GlcNAc transferase bound to a peptide from HCF-1 pro-repeat 2 (11-26) and inhibitor 3a Deposited 2018-08-25	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 197–915（719 aa）	Not recorded	JA7 5-{2-[(1R)-2-{(carboxymethyl)[(thiophen-2-yl)methyl]amino}-2-oxo-1-{[(2-oxo-1,2-dihydroquinolin-6-yl)sulfonyl]amino}ethyl]phenoxy}pentanoic acid × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；298 K；1.05 M Sodium Citrate Tribasic Dihydrate, 0.1M Tris, pH 8.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.00 Å R-free 0.220
6MA5 Crystal structure of human O-GlcNAc transferase bound to a peptide from HCF-1 pro-repeat 2 (11-26) and inhibitor 1a Deposited 2018-08-25	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 197–915（719 aa）	Not recorded	J9V N-[(2R)-2-(2-methoxyphenyl)-2-{[(2-oxo-1,2-dihydroquinolin-6-yl)sulfonyl]amino}acetyl]-N-[(thiophen-2-yl)methyl]glycine × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；298 K；1.05 M Sodium Citrate Tribasic Dihydrate, 0.1M Tris, pH 8.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.00 Å R-free 0.210
6Q4M Crystal structure of the O-GlcNAc transferase Asn648Tyr mutation Deposited 2018-12-06	Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 323–1041（719 aa）	Mutation：N648Y	12V (2S,3R,4R,5S,6R)-3-(acetylamino)-4,5-dihydroxy-6-(hydroxymethyl)tetrahydro-2H-thiopyran-2-yl [(2R,3S,4R,5R)-5-(2,4-dioxo-3,4-dihydropyrimidin-1(2H)-yl)-3,4-dihydroxytetrahydrofuran-2-yl]methyl dihydrogen diphosphate × 1 PO4 PHOSPHATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；293 K；1.45 M K2HPO4, 8 mM EDTA and 1% xylitol.	Resolution 2.20 Å R-free 0.199
6TKA Crystal structure of human O-GlcNAc transferase bound to substrate 7 and a peptide from HCF-1 pro-repeat 2 (11-26) Deposited 2019-11-28	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain AAA 197–920（724 aa）	Not recorded	NJ5 [[(2~{R},3~{S},4~{R},5~{R})-5-[2,4-bis(oxidanylidene)pyrimidin-1-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl] [(2~{R},3~{R},4~{R},5~{S},6~{R})-3-[6-(butanoylamino)hexanoylamino]-6-(hydroxymethyl)-4,5-bis(oxidanyl)oxan-2-yl] hydrogen phosphate × 1 NG8 3-[2,2-bis(fluoranyl)-10,12-dimethyl-1,3-diaza-2$l^{4}-boratricyclo[7.3.0.0^{3,7}]dodeca-4,6,9,11-tetraen-4-yl]-~{N}-ethyl-propanamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；1.45 M Potassium Sodium Tartrate 0.1 M Tris pH 8.5	Resolution 1.91 Å R-free 0.233
6TKA Crystal structure of human O-GlcNAc transferase bound to substrate 7 and a peptide from HCF-1 pro-repeat 2 (11-26) Deposited 2019-11-28	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain AAA 197–920（724 aa）	Not recorded	NJ5 [[(2~{R},3~{S},4~{R},5~{R})-5-[2,4-bis(oxidanylidene)pyrimidin-1-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl] [(2~{R},3~{R},4~{R},5~{S},6~{R})-3-[6-(butanoylamino)hexanoylamino]-6-(hydroxymethyl)-4,5-bis(oxidanyl)oxan-2-yl] hydrogen phosphate × 2 NG8 3-[2,2-bis(fluoranyl)-10,12-dimethyl-1,3-diaza-2$l^{4}-boratricyclo[7.3.0.0^{3,7}]dodeca-4,6,9,11-tetraen-4-yl]-~{N}-ethyl-propanamide × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；1.45 M Potassium Sodium Tartrate 0.1 M Tris pH 8.5	Resolution 1.91 Å R-free 0.233
7NTF Cryo-EM structure of unliganded O-GlcNAc transferase Deposited 2021-03-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 2–1036（1035 aa） Chain B 2–1036（1035 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；25 mM HEPES pH 7.5 150 mM NaCl 1 mM DTT 0.5 % glycerol cryo-EM vitrification conditions Cryogen ETHANE；Blot for 4 seconds before plunging	Resolution 5.32 Å
7YEA Human O-GlcNAc transferase Dimer Deposited 2022-07-05	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–1046（1046 aa） Chain B 1–1046（1046 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.82 Å
7YEH Cryo-EM structure of human OGT-OGA complex Deposited 2022-07-05	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 1–1046（1046 aa） Chain B 1–1046（1046 aa）	Not recorded	UDP URIDINE-5'-DIPHOSPHATE × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.92 Å
8CM9 Structure of human O-GlcNAc transferase in complex with UDP and tP11 Deposited 2023-02-18	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 323–1041（719 aa）	Not recorded	UDP URIDINE-5'-DIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；291 K；1.5 M potassium phosphate dibasic, 5 % xylitol and 10 mM EDTA	Resolution 2.80 Å R-free 0.224
8CM9 Structure of human O-GlcNAc transferase in complex with UDP and tP11 Deposited 2023-02-18	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 323–1041（719 aa）	Not recorded	UDP URIDINE-5'-DIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；291 K；1.5 M potassium phosphate dibasic, 5 % xylitol and 10 mM EDTA	Resolution 2.80 Å R-free 0.224
8CM9 Structure of human O-GlcNAc transferase in complex with UDP and tP11 Deposited 2023-02-18	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 323–1041（719 aa）	Not recorded	UDP URIDINE-5'-DIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；291 K；1.5 M potassium phosphate dibasic, 5 % xylitol and 10 mM EDTA	Resolution 2.80 Å R-free 0.224
8CM9 Structure of human O-GlcNAc transferase in complex with UDP and tP11 Deposited 2023-02-18	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 323–1041（719 aa）	Not recorded	UDP URIDINE-5'-DIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；291 K；1.5 M potassium phosphate dibasic, 5 % xylitol and 10 mM EDTA	Resolution 2.80 Å R-free 0.224
8FE6 Crystal structure of human O-GlcNAc transferase (OGT) in complex with an exosite-binding peptide and UDP-GlcNAc Deposited 2022-12-05	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 313–1031（719 aa）	Not recorded	UD1 URIDINE-DIPHOSPHATE-N-ACETYLGLUCOSAMINE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；1.45M potassium phosphate, 10mM EDTA pH 8, 1% Xylitol	Resolution 3.06 Å R-free 0.219
8FE6 Crystal structure of human O-GlcNAc transferase (OGT) in complex with an exosite-binding peptide and UDP-GlcNAc Deposited 2022-12-05	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 313–1031（719 aa）	Not recorded	UD1 URIDINE-DIPHOSPHATE-N-ACETYLGLUCOSAMINE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；1.45M potassium phosphate, 10mM EDTA pH 8, 1% Xylitol	Resolution 3.06 Å R-free 0.219
8FE6 Crystal structure of human O-GlcNAc transferase (OGT) in complex with an exosite-binding peptide and UDP-GlcNAc Deposited 2022-12-05	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain E 313–1031（719 aa）	Not recorded	UD1 URIDINE-DIPHOSPHATE-N-ACETYLGLUCOSAMINE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；1.45M potassium phosphate, 10mM EDTA pH 8, 1% Xylitol	Resolution 3.06 Å R-free 0.219
8FE6 Crystal structure of human O-GlcNAc transferase (OGT) in complex with an exosite-binding peptide and UDP-GlcNAc Deposited 2022-12-05	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain G 313–1031（719 aa）	Not recorded	UD1 URIDINE-DIPHOSPHATE-N-ACETYLGLUCOSAMINE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；1.45M potassium phosphate, 10mM EDTA pH 8, 1% Xylitol	Resolution 3.06 Å R-free 0.219
8FE7 Crystal structure of human O-GlcNAc transferase (OGT) in complex with an exosite-binding peptide (SMG9) and UDP-GlcNAc Deposited 2022-12-05	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 313–1031（719 aa）	Not recorded	UD1 URIDINE-DIPHOSPHATE-N-ACETYLGLUCOSAMINE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；1.9M Ammonium Sulfate, 0.1M Tris pH 8.5, 1% Xylitol	Resolution 2.98 Å R-free 0.217
8FE7 Crystal structure of human O-GlcNAc transferase (OGT) in complex with an exosite-binding peptide (SMG9) and UDP-GlcNAc Deposited 2022-12-05	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 313–1031（719 aa）	Not recorded	UD1 URIDINE-DIPHOSPHATE-N-ACETYLGLUCOSAMINE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；1.9M Ammonium Sulfate, 0.1M Tris pH 8.5, 1% Xylitol	Resolution 2.98 Å R-free 0.217
8FE7 Crystal structure of human O-GlcNAc transferase (OGT) in complex with an exosite-binding peptide (SMG9) and UDP-GlcNAc Deposited 2022-12-05	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain E 313–1031（719 aa）	Not recorded	UD1 URIDINE-DIPHOSPHATE-N-ACETYLGLUCOSAMINE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；1.9M Ammonium Sulfate, 0.1M Tris pH 8.5, 1% Xylitol	Resolution 2.98 Å R-free 0.217
8FE7 Crystal structure of human O-GlcNAc transferase (OGT) in complex with an exosite-binding peptide (SMG9) and UDP-GlcNAc Deposited 2022-12-05	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain G 313–1031（719 aa）	Not recorded	UD1 URIDINE-DIPHOSPHATE-N-ACETYLGLUCOSAMINE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；1.9M Ammonium Sulfate, 0.1M Tris pH 8.5, 1% Xylitol	Resolution 2.98 Å R-free 0.217
8FUF Crystal structure of human O-GlcNAc transferase (OGT) in complex with an exosite-binding peptide (ZNF831) and UDP-GlcNAc Deposited 2023-01-17	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 197–915（719 aa）	Not recorded	UD1 URIDINE-DIPHOSPHATE-N-ACETYLGLUCOSAMINE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；1.9M Ammonium Sulfate, 0.1M Tris pH=8.5, 1% Xylitol	Resolution 3.69 Å R-free 0.242
8FUF Crystal structure of human O-GlcNAc transferase (OGT) in complex with an exosite-binding peptide (ZNF831) and UDP-GlcNAc Deposited 2023-01-17	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 197–915（719 aa）	Not recorded	UD1 URIDINE-DIPHOSPHATE-N-ACETYLGLUCOSAMINE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；1.9M Ammonium Sulfate, 0.1M Tris pH=8.5, 1% Xylitol	Resolution 3.69 Å R-free 0.242
8FUF Crystal structure of human O-GlcNAc transferase (OGT) in complex with an exosite-binding peptide (ZNF831) and UDP-GlcNAc Deposited 2023-01-17	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain E 197–915（719 aa）	Not recorded	UD1 URIDINE-DIPHOSPHATE-N-ACETYLGLUCOSAMINE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；1.9M Ammonium Sulfate, 0.1M Tris pH=8.5, 1% Xylitol	Resolution 3.69 Å R-free 0.242
8FUF Crystal structure of human O-GlcNAc transferase (OGT) in complex with an exosite-binding peptide (ZNF831) and UDP-GlcNAc Deposited 2023-01-17	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain G 197–915（719 aa）	Not recorded	UD1 URIDINE-DIPHOSPHATE-N-ACETYLGLUCOSAMINE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；1.9M Ammonium Sulfate, 0.1M Tris pH=8.5, 1% Xylitol	Resolution 3.69 Å R-free 0.242

43 other PDB entries and 101 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	OGT1_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 5–723； UniProt 323–1041

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

Download Download SAXS (.dat) P(r) (.pr.out) CIF

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6ibo
Deposition date deposition_date	2018-11-30
Structure title title	Catalytic deficiency of O-GlcNAc transferase leads to X-linked intellectual disability
Keywords keywords	TRANSFERASE; TRANSFERASE
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	27.78 Å
Radius of gyration Rg (electron density) rg_electron	27.26 Å
Forward intensity I(0) i0	102903000.00
Molecular weight molecular_weight	79492.0 kDa
Excluded volume excluded_volume	99225 Å³
Envelope volume envelope_volume	118300 Å³
Hydration-shell volume shell_volume	35821 Å³
Envelope diameter envelope_diameter	101.5 Å
Shell Rg shell_rg	35.02 Å
Envelope Rg envelope_rg	27.48 Å
Shape Rg shape_rg	27.27 Å
Total Rg total_rg	27.94 Å
Total atoms total_atoms	5577
Residues n_residues	701
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	95.7 Å
Rg (real space) rg_real	27.74 Å
Rg uncertainty (real space) rg_real_error	0.66 Å
I(0) (real space) i0_real	1.0290e+08
I(0) uncertainty (real space) i0_real_error	1.5160e+06
Rg (reciprocal space) rg_reciprocal	27.75 Å
I(0) (reciprocal space) i0_reciprocal	102900000.0000
Solution quality estimate total_estimate	0.8723
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	31.9 Å
Skewness Skewness skewness	0.336
Kurtosis Kurtosis kurtosis	-0.246
Angular range angular_range	— – 0.2850 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	23490000.0000
Real-space data points n_real_points	58
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.789; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.991; Smooth: 0.977

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit
Molecular weight formula_weight	80989.6 kDa
EC 编号 ec_number	2.4.1.255
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	5895

GPGSCPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINVLHKPPYEHPKDLKLSDGRLRVGYVSSDFGKHPTSHLMQSIPGMHNPDKFEVFCYALSPDDGTNFRVKVMAEANHFIDLSQIPCNGKAADRIHQDGIHILVNMNGYTKGARNELFALRPAPIQAMWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMPHTFFIGDHANMFPHLKKKAVIDFKSNGHIYDNRIVLNGIDLKAFLDSLPDVKIVKMKCPDGGDNADSSNTALNMPVIPMNTIAEAVIEMINRGQIQITINGFSISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPEDAIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRIIFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDHMIKPVE

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	Human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	ALA-VAL-SER-ARG-ALA
Molecular weight formula_weight	932.1 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

KKVAVSRAA

Entity 3 Entity 3 non-polymer

Description description	;(2S,3R,4R,5S,6R)-3-(acetylamino)-4,5-dihydroxy-6-(hydroxymethyl)tetrahydro-2H-thiopyran-2-yl [(2R,3S,4R,5R)-5-(2,4-dioxo-3,4-dihydropyrimidin-1(2H)-yl)-3,4-dihydroxytetrahydrofuran-2-yl]methyl dihydrogen diphosphate ;
Molecular weight formula_weight	623.4 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 4 Entity 4 non-polymer

Description description	PHOSPHATE ION
Molecular weight formula_weight	95.0 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 5 Entity 5 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	318

▼

7. Fold Classification (SCOP + CATH) 3 domains

CATH v4.4 (3 domains)

Domain ID domain_id	6iboA01
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	11380 —

Domain ID domain_id	6iboA02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	720 — Signal recognition particle alu RNA binding heterodimer, srp9/1
Homologous superfamily homologous superfamily	150 —

Domain ID domain_id	6iboA03
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	2000 — Glycogen Phosphorylase B;

▶

8. Citations (1)

▶

Unit-cell length a length_a	137.737 Å
Unit-cell length b length_b	150.617 Å
Unit-cell length c length_c	199.996 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	16

Space group space_group	F 2 2 2
Space-group number int_tables_number	22
Crystal system crystal_system	—

Resolution resolution	2.170 Å
Low-resolution limit resolution_low	100.000 Å
R factor r_factor	0.2035
R_work r_work	0.2009
R_free r_free	0.2537

fit	/app/data/saxs_computation/ib/6ibo/6ibo.fit
pddf	/app/data/pr_computation/ib/6ibo/6ibo.pr.out
profile	/app/data/saxs_computation/ib/6ibo/6ibo.dat

Catalytic deficiency of O-GlcNAc transferase leads to X-linked intellectual disability

1. Protein Identity and Related Structures Protein Identity & Related Structures

UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

6. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 water

7. Fold Classification (SCOP + CATH) 3 domains

CATH v4.4 (3 domains)

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)