6jeo

Structure of PSI tetramer from Anabaena

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Photosystem I P700 chlorophyll a apoprotein A1

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 48	Photosystem I P700 chlorophyll a apoprotein A2 1 × 4 （P58565） Photosystem I iron-sulfur center × 4 （P0A410） Photosystem I reaction center subunit II × 4 （P58573） Photosystem I reaction center subunit IV × 4 （P58575） Photosystem I reaction center subunit III × 4 （P58564） Photosystem I reaction center subunit VIII × 4 （P58560） Photosystem I reaction center subunit IX × 4 （P58568） Photosystem I reaction center subunit PsaK 1 × 4 （P58583） Photosystem I reaction center subunit XI × 4 （P58577） Photosystem I reaction center subunit XII × 4 （Q8YNB0） Photosystem I 4.8 kDa protein × 4 （P58566） CHLOROPHYLL A ISOMER × 4 CHLOROPHYLL A × 376 PHYLLOQUINONE × 8 IRON/SULFUR CLUSTER × 12 BETA-CAROTENE × 88 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 12 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAA_NOSS1
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain aA； PDBConstruct 1–752； UniProt 1–752 Author chain bA； PDBConstruct 1–752； UniProt 1–752 Author chain cA； PDBConstruct 1–752； UniProt 1–752 Author chain dA； PDBConstruct 1–752； UniProt 1–752

Photosystem I P700 chlorophyll a apoprotein A2 1

OrganismNot specified

UniProt P58565

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 48	Photosystem I P700 chlorophyll a apoprotein A1 × 4 （P58576） Photosystem I iron-sulfur center × 4 （P0A410） Photosystem I reaction center subunit II × 4 （P58573） Photosystem I reaction center subunit IV × 4 （P58575） Photosystem I reaction center subunit III × 4 （P58564） Photosystem I reaction center subunit VIII × 4 （P58560） Photosystem I reaction center subunit IX × 4 （P58568） Photosystem I reaction center subunit PsaK 1 × 4 （P58583） Photosystem I reaction center subunit XI × 4 （P58577） Photosystem I reaction center subunit XII × 4 （Q8YNB0） Photosystem I 4.8 kDa protein × 4 （P58566） CHLOROPHYLL A ISOMER × 4 CHLOROPHYLL A × 376 PHYLLOQUINONE × 8 IRON/SULFUR CLUSTER × 12 BETA-CAROTENE × 88 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 12 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAB1_NOSS1
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain aB； PDBConstruct 1–741； UniProt 1–741 Author chain bB； PDBConstruct 1–741； UniProt 1–741 Author chain cB； PDBConstruct 1–741； UniProt 1–741 Author chain dB； PDBConstruct 1–741； UniProt 1–741

Photosystem I iron-sulfur center

OrganismNot specified

UniProt P0A410

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 48	Photosystem I P700 chlorophyll a apoprotein A1 × 4 （P58576） Photosystem I P700 chlorophyll a apoprotein A2 1 × 4 （P58565） Photosystem I reaction center subunit II × 4 （P58573） Photosystem I reaction center subunit IV × 4 （P58575） Photosystem I reaction center subunit III × 4 （P58564） Photosystem I reaction center subunit VIII × 4 （P58560） Photosystem I reaction center subunit IX × 4 （P58568） Photosystem I reaction center subunit PsaK 1 × 4 （P58583） Photosystem I reaction center subunit XI × 4 （P58577） Photosystem I reaction center subunit XII × 4 （Q8YNB0） Photosystem I 4.8 kDa protein × 4 （P58566） CHLOROPHYLL A ISOMER × 4 CHLOROPHYLL A × 376 PHYLLOQUINONE × 8 IRON/SULFUR CLUSTER × 12 BETA-CAROTENE × 88 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 12 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAC_NOSS1
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain aC； PDBConstruct 1–81； UniProt 1–81 Author chain bC； PDBConstruct 1–81； UniProt 1–81 Author chain cC； PDBConstruct 1–81； UniProt 1–81 Author chain dC； PDBConstruct 1–81； UniProt 1–81

Photosystem I reaction center subunit II

OrganismNot specified

UniProt P58573

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 48	Photosystem I P700 chlorophyll a apoprotein A1 × 4 （P58576） Photosystem I P700 chlorophyll a apoprotein A2 1 × 4 （P58565） Photosystem I iron-sulfur center × 4 （P0A410） Photosystem I reaction center subunit IV × 4 （P58575） Photosystem I reaction center subunit III × 4 （P58564） Photosystem I reaction center subunit VIII × 4 （P58560） Photosystem I reaction center subunit IX × 4 （P58568） Photosystem I reaction center subunit PsaK 1 × 4 （P58583） Photosystem I reaction center subunit XI × 4 （P58577） Photosystem I reaction center subunit XII × 4 （Q8YNB0） Photosystem I 4.8 kDa protein × 4 （P58566） CHLOROPHYLL A ISOMER × 4 CHLOROPHYLL A × 376 PHYLLOQUINONE × 8 IRON/SULFUR CLUSTER × 12 BETA-CAROTENE × 88 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 12 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAD_NOSS1
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain aD； PDBConstruct 1–139； UniProt 1–139 Author chain bD； PDBConstruct 1–139； UniProt 1–139 Author chain cD； PDBConstruct 1–139； UniProt 1–139 Author chain dD； PDBConstruct 1–139； UniProt 1–139

Photosystem I reaction center subunit IV

OrganismNot specified

UniProt P58575

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 48	Photosystem I P700 chlorophyll a apoprotein A1 × 4 （P58576） Photosystem I P700 chlorophyll a apoprotein A2 1 × 4 （P58565） Photosystem I iron-sulfur center × 4 （P0A410） Photosystem I reaction center subunit II × 4 （P58573） Photosystem I reaction center subunit III × 4 （P58564） Photosystem I reaction center subunit VIII × 4 （P58560） Photosystem I reaction center subunit IX × 4 （P58568） Photosystem I reaction center subunit PsaK 1 × 4 （P58583） Photosystem I reaction center subunit XI × 4 （P58577） Photosystem I reaction center subunit XII × 4 （Q8YNB0） Photosystem I 4.8 kDa protein × 4 （P58566） CHLOROPHYLL A ISOMER × 4 CHLOROPHYLL A × 376 PHYLLOQUINONE × 8 IRON/SULFUR CLUSTER × 12 BETA-CAROTENE × 88 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 12 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAE_NOSS1
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain aE； PDBConstruct 1–70； UniProt 1–70 Author chain bE； PDBConstruct 1–70； UniProt 1–70 Author chain cE； PDBConstruct 1–70； UniProt 1–70 Author chain dE； PDBConstruct 1–70； UniProt 1–70

Photosystem I reaction center subunit III

OrganismNot specified

UniProt P58564

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 48	Photosystem I P700 chlorophyll a apoprotein A1 × 4 （P58576） Photosystem I P700 chlorophyll a apoprotein A2 1 × 4 （P58565） Photosystem I iron-sulfur center × 4 （P0A410） Photosystem I reaction center subunit II × 4 （P58573） Photosystem I reaction center subunit IV × 4 （P58575） Photosystem I reaction center subunit VIII × 4 （P58560） Photosystem I reaction center subunit IX × 4 （P58568） Photosystem I reaction center subunit PsaK 1 × 4 （P58583） Photosystem I reaction center subunit XI × 4 （P58577） Photosystem I reaction center subunit XII × 4 （Q8YNB0） Photosystem I 4.8 kDa protein × 4 （P58566） CHLOROPHYLL A ISOMER × 4 CHLOROPHYLL A × 376 PHYLLOQUINONE × 8 IRON/SULFUR CLUSTER × 12 BETA-CAROTENE × 88 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 12 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAF_NOSS1
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain aF； PDBConstruct 1–164； UniProt 1–164 Author chain bF； PDBConstruct 1–164； UniProt 1–164 Author chain cF； PDBConstruct 1–164； UniProt 1–164 Author chain dF； PDBConstruct 1–164； UniProt 1–164

Photosystem I reaction center subunit VIII

OrganismNot specified

UniProt P58560

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 48	Photosystem I P700 chlorophyll a apoprotein A1 × 4 （P58576） Photosystem I P700 chlorophyll a apoprotein A2 1 × 4 （P58565） Photosystem I iron-sulfur center × 4 （P0A410） Photosystem I reaction center subunit II × 4 （P58573） Photosystem I reaction center subunit IV × 4 （P58575） Photosystem I reaction center subunit III × 4 （P58564） Photosystem I reaction center subunit IX × 4 （P58568） Photosystem I reaction center subunit PsaK 1 × 4 （P58583） Photosystem I reaction center subunit XI × 4 （P58577） Photosystem I reaction center subunit XII × 4 （Q8YNB0） Photosystem I 4.8 kDa protein × 4 （P58566） CHLOROPHYLL A ISOMER × 4 CHLOROPHYLL A × 376 PHYLLOQUINONE × 8 IRON/SULFUR CLUSTER × 12 BETA-CAROTENE × 88 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 12 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAI_NOSS1
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain aI； PDBConstruct 1–46； UniProt 1–46 Author chain bI； PDBConstruct 1–46； UniProt 1–46 Author chain cI； PDBConstruct 1–46； UniProt 1–46 Author chain dI； PDBConstruct 1–46； UniProt 1–46

Photosystem I reaction center subunit IX

OrganismNot specified

UniProt P58568

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 48	Photosystem I P700 chlorophyll a apoprotein A1 × 4 （P58576） Photosystem I P700 chlorophyll a apoprotein A2 1 × 4 （P58565） Photosystem I iron-sulfur center × 4 （P0A410） Photosystem I reaction center subunit II × 4 （P58573） Photosystem I reaction center subunit IV × 4 （P58575） Photosystem I reaction center subunit III × 4 （P58564） Photosystem I reaction center subunit VIII × 4 （P58560） Photosystem I reaction center subunit PsaK 1 × 4 （P58583） Photosystem I reaction center subunit XI × 4 （P58577） Photosystem I reaction center subunit XII × 4 （Q8YNB0） Photosystem I 4.8 kDa protein × 4 （P58566） CHLOROPHYLL A ISOMER × 4 CHLOROPHYLL A × 376 PHYLLOQUINONE × 8 IRON/SULFUR CLUSTER × 12 BETA-CAROTENE × 88 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 12 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAJ_NOSS1
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain aJ； PDBConstruct 1–49； UniProt 1–49 Author chain bJ； PDBConstruct 1–49； UniProt 1–49 Author chain cJ； PDBConstruct 1–49； UniProt 1–49 Author chain dJ； PDBConstruct 1–49； UniProt 1–49

Photosystem I reaction center subunit PsaK 1

OrganismNot specified

UniProt P58583

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 48	Photosystem I P700 chlorophyll a apoprotein A1 × 4 （P58576） Photosystem I P700 chlorophyll a apoprotein A2 1 × 4 （P58565） Photosystem I iron-sulfur center × 4 （P0A410） Photosystem I reaction center subunit II × 4 （P58573） Photosystem I reaction center subunit IV × 4 （P58575） Photosystem I reaction center subunit III × 4 （P58564） Photosystem I reaction center subunit VIII × 4 （P58560） Photosystem I reaction center subunit IX × 4 （P58568） Photosystem I reaction center subunit XI × 4 （P58577） Photosystem I reaction center subunit XII × 4 （Q8YNB0） Photosystem I 4.8 kDa protein × 4 （P58566） CHLOROPHYLL A ISOMER × 4 CHLOROPHYLL A × 376 PHYLLOQUINONE × 8 IRON/SULFUR CLUSTER × 12 BETA-CAROTENE × 88 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 12 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAK1_NOSS1
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain aK； PDBConstruct 1–86； UniProt 1–86 Author chain bK； PDBConstruct 1–86； UniProt 1–86 Author chain cK； PDBConstruct 1–86； UniProt 1–86 Author chain dK； PDBConstruct 1–86； UniProt 1–86

Photosystem I reaction center subunit XI

OrganismNot specified

UniProt P58577

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 48	Photosystem I P700 chlorophyll a apoprotein A1 × 4 （P58576） Photosystem I P700 chlorophyll a apoprotein A2 1 × 4 （P58565） Photosystem I iron-sulfur center × 4 （P0A410） Photosystem I reaction center subunit II × 4 （P58573） Photosystem I reaction center subunit IV × 4 （P58575） Photosystem I reaction center subunit III × 4 （P58564） Photosystem I reaction center subunit VIII × 4 （P58560） Photosystem I reaction center subunit IX × 4 （P58568） Photosystem I reaction center subunit PsaK 1 × 4 （P58583） Photosystem I reaction center subunit XII × 4 （Q8YNB0） Photosystem I 4.8 kDa protein × 4 （P58566） CHLOROPHYLL A ISOMER × 4 CHLOROPHYLL A × 376 PHYLLOQUINONE × 8 IRON/SULFUR CLUSTER × 12 BETA-CAROTENE × 88 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 12 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAL_NOSS1
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain aL； PDBConstruct 1–172； UniProt 1–172 Author chain bL； PDBConstruct 1–172； UniProt 1–172 Author chain cL； PDBConstruct 1–172； UniProt 1–172 Author chain dL； PDBConstruct 1–172； UniProt 1–172

Photosystem I reaction center subunit XII

OrganismNot specified

UniProt Q8YNB0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 48	Photosystem I P700 chlorophyll a apoprotein A1 × 4 （P58576） Photosystem I P700 chlorophyll a apoprotein A2 1 × 4 （P58565） Photosystem I iron-sulfur center × 4 （P0A410） Photosystem I reaction center subunit II × 4 （P58573） Photosystem I reaction center subunit IV × 4 （P58575） Photosystem I reaction center subunit III × 4 （P58564） Photosystem I reaction center subunit VIII × 4 （P58560） Photosystem I reaction center subunit IX × 4 （P58568） Photosystem I reaction center subunit PsaK 1 × 4 （P58583） Photosystem I reaction center subunit XI × 4 （P58577） Photosystem I 4.8 kDa protein × 4 （P58566） CHLOROPHYLL A ISOMER × 4 CHLOROPHYLL A × 376 PHYLLOQUINONE × 8 IRON/SULFUR CLUSTER × 12 BETA-CAROTENE × 88 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 12 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAM_NOSS1
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain aM； PDBConstruct 10–40； UniProt 2–32 Author chain bM； PDBConstruct 10–40； UniProt 2–32 Author chain cM； PDBConstruct 10–40； UniProt 2–32 Author chain dM； PDBConstruct 10–40； UniProt 2–32

Photosystem I 4.8 kDa protein

OrganismNot specified

UniProt P58566

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 48	Photosystem I P700 chlorophyll a apoprotein A1 × 4 （P58576） Photosystem I P700 chlorophyll a apoprotein A2 1 × 4 （P58565） Photosystem I iron-sulfur center × 4 （P0A410） Photosystem I reaction center subunit II × 4 （P58573） Photosystem I reaction center subunit IV × 4 （P58575） Photosystem I reaction center subunit III × 4 （P58564） Photosystem I reaction center subunit VIII × 4 （P58560） Photosystem I reaction center subunit IX × 4 （P58568） Photosystem I reaction center subunit PsaK 1 × 4 （P58583） Photosystem I reaction center subunit XI × 4 （P58577） Photosystem I reaction center subunit XII × 4 （Q8YNB0） CHLOROPHYLL A ISOMER × 4 CHLOROPHYLL A × 376 PHYLLOQUINONE × 8 IRON/SULFUR CLUSTER × 12 BETA-CAROTENE × 88 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 12 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAX_NOSS1
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain aX； PDBConstruct 1–44； UniProt 1–44 Author chain bX； PDBConstruct 1–44； UniProt 1–44 Author chain cX； PDBConstruct 1–44； UniProt 1–44 Author chain dX； PDBConstruct 1–44； UniProt 1–44

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6jeo
Deposition date deposition_date	2019-02-06
Structure title title	Structure of PSI tetramer from Anabaena
Keywords keywords	Photosystem, PHOTOSYNTHESIS; PHOTOSYNTHESIS
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6jeo__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6jeo__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6jeo__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	84.95 Å
Rg (electron density)	84.16 Å
Total Rg	84.12 Å
Atom count	94576
Residues	8774
Excluded volume	1761500 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6jeo__assembly_1__model_1`	48-meric （48）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (19)

Entity 1 Entity 1 polymer

Description description	Photosystem I P700 chlorophyll a apoprotein A1
Molecular weight formula_weight	83289.7 kDa
EC 编号 ec_number	1.97.1.12
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	aA,bA,cA,dA
Atom count atom_count	94576

MTISPPEREEKKARVIVDKDPVPTSFEKWAQPGHFDRTLARGPKTTTWIWNLHALAHDFDTHTSDLEDISRKIFAAHFGHLAVVTIWLSGMIFHGAKFSNYEAWLSDPLNVRPSAQVVWPIVGQDILNGDVGGGFHGIQITSGLFQVWRGWGITNSFQLYCTAIGGLVLAGLFLFAGWFHYHKRAPKLEWFQNVESMLNHHLQVLLGCGSLGWAGHLIHVSAPINKLMDAGVAVKDIPLPHEFILNKSLLIDLFPGFAAGLTPFFTLNWGQYADFLTFKGGLNPVTGGLWMTDIAHHHLAIAVVFIIAGHQYRTNWGIGHSIKEILENHKGPFTGEGHKGLYENLTTSWHAQLATNLAFLGSLTIIIAHHMYAMPPYPYLATDYATQLCIFTHHIWIGGFLIVGGAAHAAIFMVRDYDPVVNQNNVLDRVIRHRDAIISHLNWVCIFLGFHSFGLYIHNDTMRALGRPQDMFSDTAIQLQPVFAQWVQNLHTLAPGGTAPNALEPVSYAFGGGVLAVGGKVAMMPIALGTADFLIHHIHAFTIHVTVLILLKGVLFARSSRLIPDKANLGFRFPCDGPGRGGTCQVSGWDHVFLGLFWMYNSLSIVIFHFSWKMQSDVWGTVDAAGNVSHITGGNFAQSAITINGWLRDFLWAQASQVINSYGSALSAYGLMFLGAHFVWAFSLMFLFSGRGYWQELIESIVWAHNKLKVAPAIQPRALSITQGRAVGVAHYLLGGIATTWAFFHAHILSVG

Entity 2 Entity 2 polymer

Description description	Photosystem I P700 chlorophyll a apoprotein A2 1
Molecular weight formula_weight	83457.0 kDa
EC 编号 ec_number	1.97.1.12
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	aB,bB,cB,dB

MATKFPKFSQDLAQDPTTRRIWYAMAMGNDFESHDGMTEENLYQKIFATHFGHLAIIFLWASSLLFHVAWQGNFEQWIKDPLHVRPIAHAIWDPHFGKPAIEAFTQAGANGPVNIAYSGVYHWWYTIGMRTNTELYTGSVFLLLFASLFLFAGWLHLQPKFRPSLAWFKSAESRLNHHLAGLFGVSSLAWAGHLIHVAIPESRGQHVGWDNFLSTAPHPAGLQPFFTGNWGVYAQNPDTAGHIFSTSQGAGTAILTFLGGFHPQTESLWLTDMAHHHLAIAVLFIVAGHMYRTNFGIGHSIKEMMNAKTFFGKPVEGPFNMPHQGIYDTYNNSLHFQLGWHLACLGVVTSWVAQHMYSLPSYAFIAKDYTTQAALYTHHQYIAIFLMVGAFAHGAIFLVRDYDPEQNKGNVLERVLQHKEAIISHLSWVSLFLGFHTLGLYVHNDVVVAFGTPEKQILIEPVFAQFIQAAHGKVLYGLDTLLSNPDSVAYTAYPNYANVWLPGWLDAINSGTNSLFLTIGPGDFLVHHAIALGLHTTTLILVKGALDARGSKLMPDKKDFGYAFPCDGPGRGGTCDISAWDSFYLSLFWALNTVGWVTFYWHWKHLGIWQGNVAQFNENSTYLMGWFRDYLWANSAQLINGYNPYGVNNLSVWAWMFLFGHLVWATGFMFLISWRGYWQELIETLVWAHERTPIANLVRWKDKPVALSIVQARVVGLAHFTVGYVLTYAAFLIASTAGKFG

Entity 3 Entity 3 polymer

Description description	Photosystem I iron-sulfur center
Molecular weight formula_weight	8825.2 kDa
EC 编号 ec_number	1.97.1.12
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	aC,bC,cC,dC

MSHTVKIYDTCIGCTQCVRACPTDVLEMVPWDGCKAAQVASSPRTEDCVGCKRCETACPTDFLSIRVYLGAETTRSMGLAY

Entity 4 Entity 4 polymer

Description description	Photosystem I reaction center subunit II
Molecular weight formula_weight	15176.2 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	aD,bD,cD,dD

MAETLSGKTPLFAGSTGGLLTKAVEEEKYAITWTSPKAQVFELPTGGAATMHEGENLLYIARKEYGIALGGQLRKFKITNYKIYRILPSGETTFIHPADGVFPEKVNAGREKVRFNARSIGENPNPSQVKFSGKATYDA

Entity 5 Entity 5 polymer

Description description	Photosystem I reaction center subunit IV
Molecular weight formula_weight	7897.1 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	aE,bE,cE,dE

MVQRGSKVRILRPESYWFQDVGTVASVDQSGIKYPVIVRFDKVNYAGINTNNFAVDELIEVEAPKAKAKK

Entity 6 Entity 6 polymer

Description description	Photosystem I reaction center subunit III
Molecular weight formula_weight	17850.6 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	aF,bF,cF,dF

MRRLFALILVICLSFSFAPPAKALGADLTPCAENPAFQALAKNARNTTADPQSGQKRFERYSQALCGPEGYPHLIVDGRLDRAGDFLIPSILFLYIAGWIGWVGRAYLQAIKKDSDTEQKEIQLDLGIALPIIATGFAWPAAAVKELLSGELTAKDSEITVSPR

Entity 7 Entity 7 polymer

Description description	Photosystem I reaction center subunit VIII
Molecular weight formula_weight	5066.9 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	aI,bI,cI,dI

MATAFLPSILADASFLSSIFVPVIGWVVPIATFSFLFLYIEREDVA

Entity 8 Entity 8 polymer

Description description	Photosystem I reaction center subunit IX
Molecular weight formula_weight	5499.4 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	aJ,bJ,cJ,dJ

MADKADQSSYLIKFISTAPVAATIWLTITAGILIEFNRFFPDLLFHPLP

Entity 9 Entity 9 polymer

Description description	Photosystem I reaction center subunit PsaK 1
Molecular weight formula_weight	8852.5 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	aK,bK,cK,dK

MLTSTLLAAATTPLEWSPTVGIIMVIANVIAITFGRQTIKYPSAEPALPSAKFFGGFGAPALLATTAFGHILGVGLVLGLHNLGRI

Entity 10 Entity 10 polymer

Description description	Photosystem I reaction center subunit XI
Molecular weight formula_weight	18130.7 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	aL,bL,cL,dL

MAQAVDASKNLPSDPRNREVVFPAGRDPQWGNLETPVNASPLVKWFINNLPAYRPGLTPFRRGLEVGMAHGYFLFGPFAKLGPLRDAANANLAGLLGAIGLVVLFTLALSLYANSNPPTALASVTVPNPPDAFQSKEGWNNFASAFLIGGIGGAVVAYFLTSNLALIQGLVG

Entity 11 Entity 11 polymer

Description description	Photosystem I reaction center subunit XII
Molecular weight formula_weight	4424.2 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	aM,bM,cM,dM

MPTLYLAQVSSISDTQVYIALVVALIPGLLAWRLATELYK

Entity 12 Entity 12 polymer

Description description	Photosystem I 4.8 kDa protein
Molecular weight formula_weight	4872.8 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	aX,bX,cX,dX

MAKAKISPVANTGAKPPYTFRTGWALLLLAVNFLVAAYYFHIIQ

Entity 13 Entity 13 non-polymer

Description description	CHLOROPHYLL A ISOMER
Molecular weight formula_weight	893.5 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 14 Entity 14 non-polymer

Description description	CHLOROPHYLL A
Molecular weight formula_weight	893.5 kDa
Source method src_method	syn
Copy count entity_count	376

Entity 15 Entity 15 non-polymer

Description description	PHYLLOQUINONE
Molecular weight formula_weight	450.7 kDa
Source method src_method	syn
Copy count entity_count	8

Entity 16 Entity 16 non-polymer

Description description	IRON/SULFUR CLUSTER
Molecular weight formula_weight	351.6 kDa
Source method src_method	syn
Copy count entity_count	12

Entity 17 Entity 17 non-polymer

Description description	BETA-CAROTENE
Molecular weight formula_weight	536.9 kDa
Source method src_method	syn
Copy count entity_count	88

Entity 18 Entity 18 non-polymer

Description description	1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE
Molecular weight formula_weight	723.0 kDa
Source method src_method	syn
Copy count entity_count	12

Entity 19 Entity 19 non-polymer

Description description	1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE
Molecular weight formula_weight	787.2 kDa
Source method src_method	syn
Copy count entity_count	4

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.30 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	111400

Structure of PSI tetramer from Anabaena

1. Protein Identity and Related Structures Protein Identity & Related Structures

Photosystem I P700 chlorophyll a apoprotein A1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I P700 chlorophyll a apoprotein A2 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I iron-sulfur center

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit II

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit IV

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit III

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit VIII

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit IX

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit PsaK 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit XI

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer