SAXSdb — 6jhe

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

ECF RNA polymerase sigma factor SigW

Bacillus subtilis (strain 168)

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Monomer	Protein 1 DNA 2	;DNA (5'-D(PTPTPGPAPAPAPCPCPTPTPT)-3') ; × 1 ;DNA (5'-D(APAPAPGPGPTPTPTPCPAPA)-3') ; × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SIGW_BACSU
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 3–64； UniProt 126–187

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6jhe
Deposition date deposition_date	2019-02-18
Structure title title	Crystal Structure of Bacillus subtilis SigW domain 4 in complexed with -35 element DNA
Keywords keywords	protein-DNA complex, helix-turn-helix, TRANSCRIPTION-DNA complex; TRANSCRIPTION/DNA
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6jhe__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6jhe__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6jhe__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	14.86 Å
Rg (electron density)	13.95 Å
Total Rg	15.02 Å
Atom count	884
Residues	75
Excluded volume	14594 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6jhe__assembly_1__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	ECF RNA polymerase sigma factor SigW
Molecular weight formula_weight	7380.7 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	884

GSLSNTIQQKILKLPDKYRTVIVLKYIDELSLIEIGEILNIPVGTVKTRIHRGREALRKQLRDL

Source Source

Source organism organism	Bacillus subtilis (strain 168)
NCBI taxonomy ID ncbi_taxonomy_id	224308
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	;DNA (5'-D(PTPTPGPAPAPAPCPCPTPTP*T)-3') ;
Molecular weight formula_weight	3323.2 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	B

TTGAAACCTTT

Entity 3 Entity 3 polymer

Description description	;DNA (5'-D(APAPAPGPGPTPTPTPCPAP*A)-3') ;
Molecular weight formula_weight	3381.2 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	C

AAAGGTTTCAA

▶

Unit-cell length a length_a	61.620 Å
Unit-cell length b length_b	61.620 Å
Unit-cell length c length_c	119.971 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	120.00 °
Molecules per unit cell Z z_pdb	12

Space group space_group	P 65 2 2
Space-group number int_tables_number	179
Crystal system crystal_system	—

Resolution resolution	3.101 Å
Low-resolution limit resolution_low	29.842 Å
R factor r_factor	0.2496
R_work r_work	0.2475
R_free r_free	0.2895

Crystal Structure of Bacillus subtilis SigW domain 4 in complexed with -35 element DNA

1. Protein Identity and Related Structures Protein Identity & Related Structures

ECF RNA polymerase sigma factor SigW

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6jhe__assembly_1__model_1

6jhe__assembly_1__model_1 | I(q)

6jhe__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

7. Citations (1)

Crystal Structure of Bacillus subtilis SigW domain 4 in complexed with -35 element DNA

1. Protein Identity and Related Structures Protein Identity & Related Structures

ECF RNA polymerase sigma factor SigW

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6jhe__assembly_1__model_1

6jhe__assembly_1__model_1 | I(q)

6jhe__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

7. Citations (1)