SAXSdb — 6k73

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Colonization factor antigen I chaperone CfaA

Escherichia coli

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	CFA/I fimbrial subunit E × 1 （P25734） GLYCEROL × 4 NICKEL (II) ION × 3 water × 2	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 2	CFA/I fimbrial subunit E × 1 （P25734） NICKEL (II) ION × 1 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A3Y5Z8F9_ECOLX
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–220； UniProt 19–238 Author chain B； PDBConstruct 1–220； UniProt 19–238

CFA/I fimbrial subunit E

Escherichia coli

UniProt P25734

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	Colonization factor antigen I chaperone CfaA × 1 （A0A3Y5Z8F9） GLYCEROL × 4 NICKEL (II) ION × 3 water × 2	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 2	Colonization factor antigen I chaperone CfaA × 1 （A0A3Y5Z8F9） NICKEL (II) ION × 1 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CFAE_ECOLX
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain C； PDBConstruct 5–341； UniProt 24–360 Author chain D； PDBConstruct 5–341； UniProt 24–360

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6k73
Deposition date deposition_date	2019-06-05
Structure title title	Chaperone-tip adhesin complex is vital for synergistic activation of CFA/I fimbriae biogenesis
Keywords keywords	Enterotoxigenic Escherichia coli, chaperone-usher fimbriae, periplasmic chaperone, adhesive subunit, binding motif, CHAPERONE; CHAPERONE
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6k73__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6k73__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6k73__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	31.73 Å
Rg (electron density)	30.99 Å
Total Rg	31.45 Å
Atom count	4160
Residues	524
Excluded volume	74321 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6k73__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`6k73__assembly_2__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	Colonization factor antigen I chaperone CfaA
Molecular weight formula_weight	25263.1 kDa
Mutation mutation	T112I,L114I,V116I
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	8432

ANFMIYPISKDLKNGNSELVRVYSKSKEIQYIKIYTKKIINPGTTEEYEVDIPNWDGGLVVTPQKVILPAGASKSIRLTQFKIPKKEEVYRVYFEAVKPDSKENVIDNKKLTIEISINIIYAALIRSLPSEQNISLNISRNAKKNIIIYNNGNVRAGVKDIYFCKSSNIDDNCVKKAYNKNIYPEKSFDTLVNNNFSYVFIKLNHEGIEKEQGLIQLKVPA

Source Source

Source organism organism	Escherichia coli
NCBI taxonomy ID ncbi_taxonomy_id	562
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 2 Entity 2 polymer

Description description	CFA/I fimbrial subunit E
Molecular weight formula_weight	37875.5 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,D

HHHHDKNPGSENMTNTIGPHDRGGSSPIYNILNSYLTAYNGSHHLYDRMSFLCLSSQNTLNGACPSSDAPGTATIDGETNITLQFTEKRSLIKRELQIKGYKQFLFKNANCPSKLALNSSHFQCNREQASGATLSLYIPAGELNKLPFGGVWNAVLKLNVKRRYDTTYGTYTINITVNLTDKGNIQIWLPQFKSNARVDLNLRPTGGGTYIGRNSVDMCFYDGYSTNSSSLEIRFQDDNSKSDGKFYLKKINDDSKELVYTLSLLLAGKNLTPTNGQALNINTASLETNWNRITAVTMPEISVPVLCWPGRLQLDAKVKNPEAGQYMGNIKITFTPSSQTL

Source Source

Source organism organism	Escherichia coli
NCBI taxonomy ID ncbi_taxonomy_id	562
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 3 Entity 3 non-polymer

Description description	GLYCEROL
Molecular weight formula_weight	92.1 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 4 Entity 4 non-polymer

Description description	NICKEL (II) ION
Molecular weight formula_weight	58.7 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 5 Entity 5 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	46

▼

6. Fold Classification (SCOP + CATH) 8 domains

CATH v4.4 (8 domains)

Domain ID domain_id	6k73A01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	6k73A02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	3970 —

Domain ID domain_id	6k73B01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	6k73B02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	3970 —

Domain ID domain_id	6k73C01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	2520 — CFA/I fimbrial subunit E, adhesin domain

Domain ID domain_id	6k73C02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	2040 — CFA/I fimbrial subunit E, pilin domain

Domain ID domain_id	6k73D01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	2520 — CFA/I fimbrial subunit E, adhesin domain

Domain ID domain_id	6k73D02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	2040 — CFA/I fimbrial subunit E, pilin domain

▶

Unit-cell length a length_a	217.158 Å
Unit-cell length b length_b	217.158 Å
Unit-cell length c length_c	177.091 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	120.00 °
Molecules per unit cell Z z_pdb	36

Space group space_group	H 3 2
Space-group number int_tables_number	155
Crystal system crystal_system	—

Resolution resolution	2.774 Å
Low-resolution limit resolution_low	29.517 Å
R factor r_factor	0.2265
R_work r_work	0.2248
R_free r_free	0.2597

Chaperone-tip adhesin complex is vital for synergistic activation of CFA/I fimbriae biogenesis

1. Protein Identity and Related Structures Protein Identity & Related Structures

Colonization factor antigen I chaperone CfaA

State in the Current Structure

Other States of the Same Protein in the Database

CFA/I fimbrial subunit E

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6k73__assembly_1__model_1

6k73__assembly_1__model_1 | I(q)

6k73__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 water

6. Fold Classification (SCOP + CATH) 8 domains

CATH v4.4 (8 domains)

7. Citations (1)

Chaperone-tip adhesin complex is vital for synergistic activation of CFA/I fimbriae biogenesis

1. Protein Identity and Related Structures Protein Identity & Related Structures

Colonization factor antigen I chaperone CfaA

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

CFA/I fimbrial subunit E

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6k73__assembly_1__model_1

6k73__assembly_1__model_1 | I(q)

6k73__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 water

6. Fold Classification (SCOP + CATH) 8 domains

CATH v4.4 (8 domains)

7. Citations (1)