SAXSdb — 6l4p

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Dynein light chain 1, axonemal

Chlamydomonas reinhardtii

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	Flagellar outer dynein arm heavy chain gamma × 1 （A8JFP1） PHOSPHATE ION × 1 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL × 1 SODIUM ION × 1 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	DNAL1_CHLRE
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 2–199； UniProt 1–198

Flagellar outer dynein arm heavy chain gamma

Chlamydomonas reinhardtii

UniProt A8JFP1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	Dynein light chain 1, axonemal × 1 （Q9XHH2） PHOSPHATE ION × 1 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL × 1 SODIUM ION × 1 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A8JFP1_CHLRE
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 2–145； UniProt 1614–1757

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6l4p
Deposition date deposition_date	2019-10-19
Structure title title	Crystal structure of the complex between the axonemal outer-arm dynein light chain-1 and microtubule binding domain of gamma heavy chain
Keywords keywords	Motor protein, Complex, CONTRACTILE PROTEIN-MOTOR PROTEIN complex; CONTRACTILE PROTEIN/MOTOR PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6l4p__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6l4p__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6l4p__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	21.37 Å
Rg (electron density)	20.22 Å
Total Rg	21.16 Å
Atom count	2635
Residues	333
Excluded volume	47360 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6l4p__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Description description	Dynein light chain 1, axonemal
Molecular weight formula_weight	22236.6 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	2846

GMAKATTIKDAIRIFEERKSVVATEAEKVELHGMIPPIEKMDATLSTLKACKHLALSTNNIEKISSLSGMENLRILSLGRNLIKKIENLDAVADTLEELWISYNQIASLSGIEKLVNLRVLYMSNNKITNWGEIDKLAALDKLEDLLLAGNPLYNDYKENNATSEYRIEVVKRLPNLKKLDGMPVDVDEREQANVARGG

Source Source

Source organism organism	Chlamydomonas reinhardtii
NCBI taxonomy ID ncbi_taxonomy_id	3055
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Flagellar outer dynein arm heavy chain gamma
Molecular weight formula_weight	16235.6 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

GDLAAAKPALDAALEALNSIKDGDIKNLKALKKPPQIITRIFDCVLVLRMLPVTKAEYTDEKGRMVQVGNYPEAQKMMNQMSFLQDLKDFAKEQINDETVELLEPYFMSEDFTFENAQKASGNVAGLCNWAESMAKYHNVAKVVE

Source Source

Source organism organism	Chlamydomonas reinhardtii
NCBI taxonomy ID ncbi_taxonomy_id	3055
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 non-polymer

Description description	PHOSPHATE ION
Molecular weight formula_weight	95.0 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 4 Entity 4 non-polymer

Description description	2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL
Molecular weight formula_weight	122.1 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 5 Entity 5 non-polymer

Description description	SODIUM ION
Molecular weight formula_weight	23.0 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 6 Entity 6 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	157

▼

6. Fold Classification (SCOP + CATH) 1 domains

SCOP 2.08 (1 domains)

Domain ID domain_id	d6l4pa_
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.10 — Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
Superfamily Superfamily superfamily	c.10.3 — Outer arm dynein light chain 1
Family Family family	c.10.3.1 — Outer arm dynein light chain 1

▶

Unit-cell length a length_a	44.550 Å
Unit-cell length b length_b	73.028 Å
Unit-cell length c length_c	94.564 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	4

Space group space_group	P 21 21 21
Space-group number int_tables_number	19
Crystal system crystal_system	—

Resolution resolution	1.703 Å
Low-resolution limit resolution_low	39.689 Å
R factor r_factor	0.1746
R_work r_work	0.1725
R_free r_free	0.2139

Crystal structure of the complex between the axonemal outer-arm dynein light chain-1 and microtubule binding domain of gamma heavy chain

1. Protein Identity and Related Structures Protein Identity & Related Structures

Dynein light chain 1, axonemal

State in the Current Structure

Other States of the Same Protein in the Database

Flagellar outer dynein arm heavy chain gamma

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6l4p__assembly_1__model_1

6l4p__assembly_1__model_1 | I(q)

6l4p__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 water

6. Fold Classification (SCOP + CATH) 1 domains

SCOP 2.08 (1 domains)

7. Citations (1)

Crystal structure of the complex between the axonemal outer-arm dynein light chain-1 and microtubule binding domain of gamma heavy chain

1. Protein Identity and Related Structures Protein Identity & Related Structures

Dynein light chain 1, axonemal

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Flagellar outer dynein arm heavy chain gamma

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6l4p__assembly_1__model_1

6l4p__assembly_1__model_1 | I(q)

6l4p__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 water

6. Fold Classification (SCOP + CATH) 1 domains

SCOP 2.08 (1 domains)

7. Citations (1)