SAXSdb — 6le5

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Calcium uptake protein 1, mitochondrial

Homo sapiens

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	Calcium uptake protein 2, mitochondrial × 1 （Q8IYU8）	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 2	Calcium uptake protein 2, mitochondrial × 1 （Q8IYU8）	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 2	Calcium uptake protein 2, mitochondrial × 1 （Q8IYU8）	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 2	Calcium uptake protein 2, mitochondrial × 1 （Q8IYU8）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MICU1_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–348； UniProt 97–444 Author chain D； PDBConstruct 1–348； UniProt 97–444 Author chain E； PDBConstruct 1–348； UniProt 97–444 Author chain G； PDBConstruct 1–348； UniProt 97–444

Calcium uptake protein 2, mitochondrial

Homo sapiens

UniProt Q8IYU8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	Calcium uptake protein 1, mitochondrial × 1 （Q9BPX6）	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 2	Calcium uptake protein 1, mitochondrial × 1 （Q9BPX6）	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 2	Calcium uptake protein 1, mitochondrial × 1 （Q9BPX6）	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 2	Calcium uptake protein 1, mitochondrial × 1 （Q9BPX6）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MICU2_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 8–325； UniProt 84–401 Author chain C； PDBConstruct 8–325； UniProt 84–401 Author chain F； PDBConstruct 8–325； UniProt 84–401 Author chain H； PDBConstruct 8–325； UniProt 84–401

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6le5
Deposition date deposition_date	2019-11-24
Structure title title	Crystal structure of the mitochondrial calcium uptake 1 and 2 heterodimer (MICU1-MICU2 heterodimer) in an apo state
Keywords keywords	Complex, Mitochondrial calcium uptake 1 and mitochondrial calcium uptake 2, METAL BINDING PROTEIN; METAL BINDING PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6le5__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6le5__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6le5__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	28.76 Å
Rg (electron density)	27.83 Å
Total Rg	28.55 Å
Atom count	4100
Residues	510
Excluded volume	72845 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6le5__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`6le5__assembly_2__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`6le5__assembly_3__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
4	1	`6le5__assembly_4__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Description description	Calcium uptake protein 1, mitochondrial
Molecular weight formula_weight	40204.9 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,D,E,G
Atom count atom_count	17392

EEKKKKRSGFRDRKVMEYENRIRAYSTPDKIFRYFATLKVISEPGEAEVFMTPEDFVRSITPNEKQPEHLGLDQYIIKRFDGKKISQEREKFADEGSIFYTLGECGLISFSDYIFLTTVLSTPQRNFEIAFKMFDLNGDGEVDMEEFEQVQSIIRSQTSMGMRHRDRPTTGNTLKSGLCSALTTYFFGADLKGKLTIKNFLEFQRKLQHDVLKLEFERHDPVDGRITERQFGGMLLAYSGVQSKKLTAMQRQLKKHFKEGKGLTFQEVENFFTFLKNINDVDTALSFYHMAGASLDKVTMQQVARTVAKVELSDHVCDVVFALFDCDGNGELSNKEFVSIMKQRLMRG

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Calcium uptake protein 2, mitochondrial
Molecular weight formula_weight	39314.7 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,C,F,H

HHHHHHMSLRKQRFMQFSSLEHEGEYYMTPRDFLFSVMFEQMERKTSVKKLTKKDIEDTLSGIQTAGCGSTFFRDLGDKGLISYTEYLFLLTILTKPHSGFHVAFKMLDTDGNEMIEKREFFKLQKIISKQDDLMTVKTNETGYQEAIVKEPEINTTLQMRFFGKRGQRKLHYKEFRRFMENLQTEIQEMEFLQFSKGLSFMRKEDFAEWLLFFTNTENKDIYWKNVREKLSAGESISLDEFKSFCHFTTHLEDFAIAMQMFSLAHRPVRLAEFKRAVKVATGQELSNNILDTVFKIFDLDGDECLSHEEFLGVLKNRMHRGLWV

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

▶

Unit-cell length a length_a	62.970 Å
Unit-cell length b length_b	173.720 Å
Unit-cell length c length_c	148.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	93.88 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	—

Resolution resolution	3.100 Å
Low-resolution limit resolution_low	50.010 Å
R factor r_factor	0.2947
R_work r_work	0.2928
R_free r_free	0.3316

Crystal structure of the mitochondrial calcium uptake 1 and 2 heterodimer (MICU1-MICU2 heterodimer) in an apo state

1. Protein Identity and Related Structures Protein Identity & Related Structures

Calcium uptake protein 1, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Calcium uptake protein 2, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6le5__assembly_1__model_1

6le5__assembly_1__model_1 | I(q)

6le5__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

7. Citations (1)

Crystal structure of the mitochondrial calcium uptake 1 and 2 heterodimer (MICU1-MICU2 heterodimer) in an apo state

1. Protein Identity and Related Structures Protein Identity & Related Structures

Calcium uptake protein 1, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Calcium uptake protein 2, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6le5__assembly_1__model_1

6le5__assembly_1__model_1 | I(q)

6le5__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

7. Citations (1)