SAXSdb — 6lo8

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Mitochondrial import inner membrane translocase subunit TIM22

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 10	Mitochondrial import inner membrane translocase subunit TIM54 × 1 （P47045） Succinate dehydrogenase [ubiquinone] cytochrome b subunit, mitochondrial × 1 （P33421） Mitochondrial import inner membrane translocase subunit TIM18 × 1 （Q08749） Mitochondrial import inner membrane translocase subunit TIM9 × 3 （O74700） Mitochondrial import inner membrane translocase subunit TIM12 × 1 （P32830） Mitochondrial import inner membrane translocase subunit TIM10 × 2 （P87108）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TIM22_YEAST
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–206； UniProt 1–206

Mitochondrial import inner membrane translocase subunit TIM54

OrganismNot specified

UniProt P47045

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 10	Mitochondrial import inner membrane translocase subunit TIM22 × 1 （Q12328） Succinate dehydrogenase [ubiquinone] cytochrome b subunit, mitochondrial × 1 （P33421） Mitochondrial import inner membrane translocase subunit TIM18 × 1 （Q08749） Mitochondrial import inner membrane translocase subunit TIM9 × 3 （O74700） Mitochondrial import inner membrane translocase subunit TIM12 × 1 （P32830） Mitochondrial import inner membrane translocase subunit TIM10 × 2 （P87108）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TIM54_YEAST
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–478； UniProt 1–478

Succinate dehydrogenase [ubiquinone] cytochrome b subunit, mitochondrial

OrganismNot specified

UniProt P33421

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 10	Mitochondrial import inner membrane translocase subunit TIM22 × 1 （Q12328） Mitochondrial import inner membrane translocase subunit TIM54 × 1 （P47045） Mitochondrial import inner membrane translocase subunit TIM18 × 1 （Q08749） Mitochondrial import inner membrane translocase subunit TIM9 × 3 （O74700） Mitochondrial import inner membrane translocase subunit TIM12 × 1 （P32830） Mitochondrial import inner membrane translocase subunit TIM10 × 2 （P87108）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SDH3_YEAST
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–198； UniProt 1–198

Mitochondrial import inner membrane translocase subunit TIM18

OrganismNot specified

UniProt Q08749

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 10	Mitochondrial import inner membrane translocase subunit TIM22 × 1 （Q12328） Mitochondrial import inner membrane translocase subunit TIM54 × 1 （P47045） Succinate dehydrogenase [ubiquinone] cytochrome b subunit, mitochondrial × 1 （P33421） Mitochondrial import inner membrane translocase subunit TIM9 × 3 （O74700） Mitochondrial import inner membrane translocase subunit TIM12 × 1 （P32830） Mitochondrial import inner membrane translocase subunit TIM10 × 2 （P87108）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TIM18_YEAST
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 1–192； UniProt 1–192

Mitochondrial import inner membrane translocase subunit TIM9

OrganismNot specified

UniProt O74700

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 10	Mitochondrial import inner membrane translocase subunit TIM22 × 1 （Q12328） Mitochondrial import inner membrane translocase subunit TIM54 × 1 （P47045） Succinate dehydrogenase [ubiquinone] cytochrome b subunit, mitochondrial × 1 （P33421） Mitochondrial import inner membrane translocase subunit TIM18 × 1 （Q08749） Mitochondrial import inner membrane translocase subunit TIM12 × 1 （P32830） Mitochondrial import inner membrane translocase subunit TIM10 × 2 （P87108）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TIM9_YEAST
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain E； PDBConstruct 1–87； UniProt 1–87 Author chain G； PDBConstruct 1–87； UniProt 1–87 Author chain I； PDBConstruct 1–87； UniProt 1–87

Mitochondrial import inner membrane translocase subunit TIM12

OrganismNot specified

UniProt P32830

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 10	Mitochondrial import inner membrane translocase subunit TIM22 × 1 （Q12328） Mitochondrial import inner membrane translocase subunit TIM54 × 1 （P47045） Succinate dehydrogenase [ubiquinone] cytochrome b subunit, mitochondrial × 1 （P33421） Mitochondrial import inner membrane translocase subunit TIM18 × 1 （Q08749） Mitochondrial import inner membrane translocase subunit TIM9 × 3 （O74700） Mitochondrial import inner membrane translocase subunit TIM10 × 2 （P87108）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TIM12_YEAST
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain F； PDBConstruct 1–109； UniProt 1–109

Mitochondrial import inner membrane translocase subunit TIM10

OrganismNot specified

UniProt P87108

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 10	Mitochondrial import inner membrane translocase subunit TIM22 × 1 （Q12328） Mitochondrial import inner membrane translocase subunit TIM54 × 1 （P47045） Succinate dehydrogenase [ubiquinone] cytochrome b subunit, mitochondrial × 1 （P33421） Mitochondrial import inner membrane translocase subunit TIM18 × 1 （Q08749） Mitochondrial import inner membrane translocase subunit TIM9 × 3 （O74700） Mitochondrial import inner membrane translocase subunit TIM12 × 1 （P32830）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TIM10_YEAST
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain H； PDBConstruct 1–93； UniProt 1–93 Author chain J； PDBConstruct 1–93； UniProt 1–93

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6lo8
Deposition date deposition_date	2020-01-04
Structure title title	Cryo-EM structure of the TIM22 complex from yeast
Keywords keywords	mitochondrial import, Tim22, protein translocation, membrane protein insertion, PROTEIN TRANSPORT; PROTEIN TRANSPORT
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6lo8__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6lo8__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6lo8__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	36.20 Å
Rg (electron density)	36.31 Å
Total Rg	36.68 Å
Atom count	7972
Residues	997
Excluded volume	142560 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6lo8__assembly_1__model_1`	decameric （10）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Description description	Mitochondrial import inner membrane translocase subunit TIM22
Molecular weight formula_weight	21751.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	7972

MVYTGFGLEQISPAQKKPYNELTPEEQGERGAEMIMNFMTSCPGKSVVSGVTGFALGGVLGLFMASMAYDTPLHTPTPANTAATATAGNIGVGGISRTVQQISDLPFRQQMKLQFTDMGKKSYSSAKNFGYIGMIYAGVECVIESLRAKNDIYNGVTAGFFTGAGLAYKAGPQAALMGGAGFAAFSAAIDLYMKSEDGRPPQNDFK

Entity 2 Entity 2 polymer

Description description	Mitochondrial import inner membrane translocase subunit TIM54
Molecular weight formula_weight	54252.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MSSESGKPIAKPIRKPGYTNPALKALGIPALRLPSRNWMIFWSVLTVSIGGIAYDKYKQRQILSHATDLVKPLAEESMEVDKVPRKITVFIAPPPNDYLESSLKVWRRYVKPVLYYAGLDYELVQEDRQGIIRTNVANRIRELRKEILASTDGQPVKEPNQTVAKPSGSSTSKISSLLPFNKIIQDPAEEDDSFDPEIGKKFKENFDWRNVIGIFYTMPKPKHIISEDALTKDPILSGGVICLGRGAYKEYIAGIHEGLLGPIEKTEKTGSTEPKMTGVVEANQIESKVSESGATELVDAEKETALEEAKVQDDLKVDEENSSEDSQKFLKPFISSDQYPDLQIASELQTPNGEFIRNPNTNIPLLINQPLLVIPIPNLIGFTTIPRRIHRFYQKRFYVEDVCSSVVNCVRQTRIRPFDIAKDIDLAKDEEKDWPQNWVKQGKEKNSEWTQELVCDPRITKHMFVYEKPPKEEPESDI

Entity 3 Entity 3 polymer

Description description	Succinate dehydrogenase [ubiquinone] cytochrome b subunit, mitochondrial
Molecular weight formula_weight	22095.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

MSAMMVKLGLNKSALLLKPSAFSRAAALSSSRRLLFNTARTNFLSTSPLKNVASEMNTKAAIAEEQILNKQRAKRPISPHLTIYQPQLTWYLSSLHRISLVLMGLGFYLFTILFGVSGLLGLGLTTEKVSNWYHQKFSKITEWSIKGSFAYLFAIHYGGAIRHLIWDTAKELTLKGVYRTGYALIGFTAVLGTYLLTL

Entity 4 Entity 4 polymer

Description description	Mitochondrial import inner membrane translocase subunit TIM18
Molecular weight formula_weight	21994.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

MLLFPGLKPVLNASTVIVNPVRAVFPGLVLSTKRSFYSINRLNAENKINDIANTSKEASSSVQMFKPPEFSQFKDSYQKDYERIAKYTLIPLTMVPFYASFTGGVINPLLDASLSSIFLIYLQYGFTSCIIDYIPKEKYPRWHKLALYCLYGGSMLSLYGIYELETKNNGFVDLVKKLWNENDDHLYIFGRN

Entity 5 Entity 5 polymer

Description description	Mitochondrial import inner membrane translocase subunit TIM9
Molecular weight formula_weight	10216.6 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,G,I

MDALNSKEQQEFQKVVEQKQMKDFMRLYSNLVERCFTDCVNDFTTSKLTNKEQTCIMKCSEKFLKHSERVGQRFQEQNAALGQGLGR

Entity 6 Entity 6 polymer

Description description	Mitochondrial import inner membrane translocase subunit TIM12
Molecular weight formula_weight	12300.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

MSFFLNSLRGNQEVSQEKLDVAGVQFDAMCSTFNNILSTCLEKCIPHEGFGEPDLTKGEQCCIDRCVAKMHYSNRLIGGFVQTRGFGPENQLRHYSRFVAKEIADDSKK

Entity 7 Entity 7 polymer

Description description	Mitochondrial import inner membrane translocase subunit TIM10
Molecular weight formula_weight	10313.6 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H,J

MSFLGFGGGQPQLSSQQKIQAAEAELDLVTDMFNKLVNNCYKKCINTSYSEGELNKNESSCLDRCVAKYFETNVQVGENMQKMGQSFNAAGKF

▼

6. Fold Classification (SCOP + CATH) 4 domains

CATH v4.4 (4 domains)

Domain ID domain_id	6lo8E01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	810 — Mitochondrial import inner membrane translocase subunit tim13 like domains

Domain ID domain_id	6lo8F01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	810 — Mitochondrial import inner membrane translocase subunit tim13 like domains

Domain ID domain_id	6lo8G01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	810 — Mitochondrial import inner membrane translocase subunit tim13 like domains

Domain ID domain_id	6lo8I01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	810 — Mitochondrial import inner membrane translocase subunit tim13 like domains

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	triclinic

Resolution resolution	3.83 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	251984

Cryo-EM structure of the TIM22 complex from yeast

1. Protein Identity and Related Structures Protein Identity & Related Structures

Mitochondrial import inner membrane translocase subunit TIM22

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Mitochondrial import inner membrane translocase subunit TIM54

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Succinate dehydrogenase [ubiquinone] cytochrome b subunit, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Mitochondrial import inner membrane translocase subunit TIM18

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Mitochondrial import inner membrane translocase subunit TIM9

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Mitochondrial import inner membrane translocase subunit TIM12

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Mitochondrial import inner membrane translocase subunit TIM10

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6lo8__assembly_1__model_1

6lo8__assembly_1__model_1 | I(q)

6lo8__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 polymer

Polymer Polymer

Entity 6 Entity 6 polymer

Polymer Polymer