SAXSdb — 6mez

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Bacteriochlorophyll a protein

Prosthecochloris aestuarii

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein homooligomer	Homooligomer	Protein 3	BACTERIOCHLOROPHYLL A × 21 SULFATE ION × 9 water × 3	Consistent with protein count
2	Protein homooligomer	Homooligomer	Protein 3	BACTERIOCHLOROPHYLL A × 21 SULFATE ION × 9 water × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	BCPA_PROAE
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–360； UniProt 7–366 Author chain B； PDBConstruct 1–360； UniProt 7–366

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6mez
Deposition date deposition_date	2018-09-07
Structure title title	X-ray structure of the Fenna-Matthews-Olsen antenna complex from Prosthecochloris aestuarii
Keywords keywords	FMO Photosynthesis Antenna complex, Energy transfer, PHOTOSYNTHESIS; PHOTOSYNTHESIS
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6mez__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6mez__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6mez__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	31.83 Å
Rg (electron density)	29.96 Å
Total Rg	30.90 Å
Atom count	9657
Residues	1074
Excluded volume	174230 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6mez__assembly_1__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`6mez__assembly_2__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	Bacteriochlorophyll a protein
Molecular weight formula_weight	39663.4 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	7812

DTTTAHSDYEIILEGGSSSWGQVKGRAKVNVPAAIPLLPTDCNIRIDAKPLDAQKGVVRFTTKIESVVDSVKNTLNVEVDIANETKDRRIAVGEGSLSVGDFSHSFSFEGSVVNMYYYRSDAVRRNIPNPIYMQGRQFHDILMKVPLDNNDLVDTWEGFQQSISGGGANFGDWIREFWFIGPAFAAINEGGQRISPIVVNSSNVEGGEKGPVGVTRWKFSHAGSGVVDSISRWTELFPVEQLNKPASIEGGFRSDSQGIEVKVDGNLPGVSRDAGGGLRRILNHPLIPLVHHGMVGKFNDFTVDTQLKIVLPKGYKIRYAAPQFRSQNLEEYRWSGGAYARWVEHVCKGGTGQFEVLYAQ

Source Source

Source organism organism	Prosthecochloris aestuarii
NCBI taxonomy ID ncbi_taxonomy_id	1102
Host organism host_organism	Prosthecochloris aestuarii

Entity 2 Entity 2 non-polymer

Description description	BACTERIOCHLOROPHYLL A
Molecular weight formula_weight	911.5 kDa
Source method src_method	syn
Copy count entity_count	14

Entity 3 Entity 3 non-polymer

Description description	SULFATE ION
Molecular weight formula_weight	96.1 kDa
Source method src_method	syn
Copy count entity_count	6

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	474

▼

6. Fold Classification (SCOP + CATH) 4 domains

SCOP 2.08 (2 domains)

Domain ID domain_id	d6meza_
Class class	b — All beta proteins
Fold Fold fold	b.75 — Bacteriochlorophyll A protein
Superfamily Superfamily superfamily	b.75.1 — Bacteriochlorophyll A protein
Family Family family	b.75.1.1 — Bacteriochlorophyll A protein

Domain ID domain_id	d6mezb_
Class class	b — All beta proteins
Fold Fold fold	b.75 — Bacteriochlorophyll A protein
Superfamily Superfamily superfamily	b.75.1 — Bacteriochlorophyll A protein
Family Family family	b.75.1.1 — Bacteriochlorophyll A protein

CATH v4.4 (2 domains)

Domain ID domain_id	6mezA00
Class class	2 — Mainly Beta
Architecture architecture	50 — Clam
Topology topology	10 — Bacteriochlorophyll-a Protein
Homologous superfamily homologous superfamily	10 — Bacteriochlorophyll A

Domain ID domain_id	6mezB00
Class class	2 — Mainly Beta
Architecture architecture	50 — Clam
Topology topology	10 — Bacteriochlorophyll-a Protein
Homologous superfamily homologous superfamily	10 — Bacteriochlorophyll A

▶

Unit-cell length a length_a	83.638 Å
Unit-cell length b length_b	83.638 Å
Unit-cell length c length_c	294.781 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	120.00 °
Molecules per unit cell Z z_pdb	18

Space group space_group	H 3
Space-group number int_tables_number	146
Crystal system crystal_system	—

Resolution resolution	1.740 Å
Low-resolution limit resolution_low	19.650 Å
R factor r_factor	0.1336
R_work r_work	0.1323
R_free r_free	0.1586

X-ray structure of the Fenna-Matthews-Olsen antenna complex from Prosthecochloris aestuarii

1. Protein Identity and Related Structures Protein Identity & Related Structures

Bacteriochlorophyll a protein

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6mez__assembly_1__model_1

6mez__assembly_1__model_1 | I(q)

6mez__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 4 domains

SCOP 2.08 (2 domains)

CATH v4.4 (2 domains)

7. Citations (1)

X-ray structure of the Fenna-Matthews-Olsen antenna complex from Prosthecochloris aestuarii

1. Protein Identity and Related Structures Protein Identity & Related Structures

Bacteriochlorophyll a protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6mez__assembly_1__model_1

6mez__assembly_1__model_1 | I(q)

6mez__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 4 domains

SCOP 2.08 (2 domains)

CATH v4.4 (2 domains)

7. Citations (1)