6n2y

Bacillus PS3 ATP synthase class 1

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

ATP synthase subunit alpha

Bacillus sp. (strain PS3)

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 22	ATP synthase subunit beta × 3 （A0A0M4U1P9） ATP synthase gamma chain × 1 （A0A0M4TPJ7） ATP synthase epsilon chain × 1 （A0A0M5MQR7） ATP synthase subunit delta × 1 ATP synthase subunit b × 1 ATP synthase subunit b × 1 ATP synthase subunit a × 1 ATP synthase subunit c × 10 （P00845） ADENOSINE-5'-TRIPHOSPHATE × 3 MAGNESIUM ION × 4 PHOSPHATE ION × 1 ADENOSINE-5'-DIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A0M3VGF9_BACP3
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–502； UniProt 1–502 Author chain B； PDBConstruct 1–502； UniProt 1–502 Author chain C； PDBConstruct 1–502； UniProt 1–502

ATP synthase subunit beta

Bacillus sp. (strain PS3)

UniProt A0A0M4U1P9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 22	ATP synthase subunit alpha × 3 （A0A0M3VGF9） ATP synthase gamma chain × 1 （A0A0M4TPJ7） ATP synthase epsilon chain × 1 （A0A0M5MQR7） ATP synthase subunit delta × 1 ATP synthase subunit b × 1 ATP synthase subunit b × 1 ATP synthase subunit a × 1 ATP synthase subunit c × 10 （P00845） ADENOSINE-5'-TRIPHOSPHATE × 3 MAGNESIUM ION × 4 PHOSPHATE ION × 1 ADENOSINE-5'-DIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A0M4U1P9_BACP3
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain D； PDBConstruct 1–473； UniProt 1–473 Author chain E； PDBConstruct 1–473； UniProt 1–473 Author chain F； PDBConstruct 1–473； UniProt 1–473

ATP synthase gamma chain

Bacillus sp. (strain PS3)

UniProt A0A0M4TPJ7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 22	ATP synthase subunit alpha × 3 （A0A0M3VGF9） ATP synthase subunit beta × 3 （A0A0M4U1P9） ATP synthase epsilon chain × 1 （A0A0M5MQR7） ATP synthase subunit delta × 1 ATP synthase subunit b × 1 ATP synthase subunit b × 1 ATP synthase subunit a × 1 ATP synthase subunit c × 10 （P00845） ADENOSINE-5'-TRIPHOSPHATE × 3 MAGNESIUM ION × 4 PHOSPHATE ION × 1 ADENOSINE-5'-DIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A0M4TPJ7_BACP3
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain G； PDBConstruct 1–285； UniProt 1–285

ATP synthase epsilon chain

Bacillus sp. (strain PS3)

UniProt A0A0M5MQR7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 22	ATP synthase subunit alpha × 3 （A0A0M3VGF9） ATP synthase subunit beta × 3 （A0A0M4U1P9） ATP synthase gamma chain × 1 （A0A0M4TPJ7） ATP synthase subunit delta × 1 ATP synthase subunit b × 1 ATP synthase subunit b × 1 ATP synthase subunit a × 1 ATP synthase subunit c × 10 （P00845） ADENOSINE-5'-TRIPHOSPHATE × 3 MAGNESIUM ION × 4 PHOSPHATE ION × 1 ADENOSINE-5'-DIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A0M5MQR7_BACP3
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain H； PDBConstruct 1–133； UniProt 1–133

ATP synthase subunit c

Bacillus sp. (strain PS3)

UniProt P00845

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 22	ATP synthase subunit alpha × 3 （A0A0M3VGF9） ATP synthase subunit beta × 3 （A0A0M4U1P9） ATP synthase gamma chain × 1 （A0A0M4TPJ7） ATP synthase epsilon chain × 1 （A0A0M5MQR7） ATP synthase subunit delta × 1 ATP synthase subunit b × 1 ATP synthase subunit b × 1 ATP synthase subunit a × 1 ADENOSINE-5'-TRIPHOSPHATE × 3 MAGNESIUM ION × 4 PHOSPHATE ION × 1 ADENOSINE-5'-DIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ATPL_BACP3
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain c0； PDBConstruct 1–72； UniProt 1–72 Author chain c1； PDBConstruct 1–72； UniProt 1–72 Author chain c2； PDBConstruct 1–72； UniProt 1–72 Author chain c3； PDBConstruct 1–72； UniProt 1–72 Author chain c4； PDBConstruct 1–72； UniProt 1–72 Author chain c5； PDBConstruct 1–72； UniProt 1–72 Author chain c6； PDBConstruct 1–72； UniProt 1–72 Author chain c7； PDBConstruct 1–72； UniProt 1–72 Author chain c8； PDBConstruct 1–72； UniProt 1–72 Author chain c9； PDBConstruct 1–72； UniProt 1–72

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6n2y
Deposition date deposition_date	2018-11-14
Structure title title	Bacillus PS3 ATP synthase class 1
Keywords keywords	Bacterial ATP synthase, HYDROLASE; HYDROLASE
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6n2y__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6n2y__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6n2y__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	61.04 Å
Rg (electron density)	62.85 Å
Total Rg	62.76 Å
Atom count	35043
Residues	4713
Excluded volume	627860 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6n2y__assembly_1__model_1`	22-meric （22）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (13)

Entity 1 Entity 1 polymer

Description description	ATP synthase subunit alpha
Molecular weight formula_weight	54848.6 kDa
EC 编号 ec_number	3.6.3.14
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C
Atom count atom_count	35043

MSIRAEEISALIKQQIENYESQIQVSDVGTVIQVGDGIARAHGLDNVMSGELVEFANGVMGMALNLEENNVGIVILGPYTGIKEGDEVRRTGRIMEVPVGEALIGRVVNPLGQPVDGLGPVETTETRPIESPAPGVMDRRSVHEPLQTGIKAIDALVPIGRGQRELIIGDRQTGKTSVAIDTIINQKDQNMISIYVAIGQKESTVRTVVETLRKHGALDYTIVVTASASQPAPLLFLAPYAGVAMGEYFMYKGKHVLVVYDDLSKQAAAYRELSLLLRRPPGREAYPGDIFYLHSRLLERAAKLSDAKGGGSLTALPFVETQAGDISAYIPTNVISITDGQIFLQSDLFFSGVRPAINAGLSVSRVGGAAQIKAMKKVAGTLRLDLAAYRELEAFAQFGSDLDKATQAKLARGARTVEVLKQDLHQPIPVEKQVLIIYALTRGFLDDIPVEDVRRFEKEFYLFLDQNGQHLLEHIRTTKDLPNEDDLNKAIEAFKKTFVVSQ

Source Source

Source organism organism	Bacillus sp. (strain PS3)
NCBI taxonomy ID ncbi_taxonomy_id	2334
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	ATP synthase subunit beta
Molecular weight formula_weight	51912.0 kDa
EC 编号 ec_number	3.6.3.14
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,E,F

MTRGRVIQVMGPVVDVKFENGHLPAIYNALKIQHKARNENEVDIDLTLEVALHLGDDTVRTIAMASTDGLIRGMEVIDTGAPISVPVGEVTLGRVFNVLGEPIDLEGDIPADARRDPIHRPAPKFEELATEVEILETGIKVVDLLAPYIKGGKIGLFGGAGVGKTVLIQELIHNIAQEHGGISVFAGVGERTREGNDLYHEMKDSGVISKTAMVFGQMNEPPGARMRVALTGLTMAEYFRDEQGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTAKGSITSIQAIYVPADDYTDPAPATTFSHLDATTNLERKLAEMGIYPAVDPLASTSRALAPEIVGEEHYQVARKVQQTLQRYKELQDIIAILGMDELSDEDKLVVHRARRIQFFLSQNFHVAEQFTGQPGSYVPVKETVRGFKEILEGKYDHLPEDAFRLVGRIEEVVEKAKAMGVEV

Source Source

Source organism organism	Bacillus sp. (strain PS3)
NCBI taxonomy ID ncbi_taxonomy_id	2334
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 polymer

Description description	ATP synthase gamma chain
Molecular weight formula_weight	31859.5 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

MASLRDIKTRINATKKTSQITKAMEMVSTSKLNRAEQNAKSFVPYMEKIQEVVANVALGAGGASHPMLVSRPVKKTGYLVITSDRGLAGAYNSNVLRLVYQTIQKRHASPDEYAIIVIGRVGLSFFRKRNMPVILDITRLPDQPSFADIKEIARKTVGLFADGTFDELYMYYNHYVSAIQQEVTERKLLPLTDLAENKQRTVYEFEPSQEEILDVLLPQYAESLIYGALLDAKASEHAARMTAMKNATDNANELIRTLTLSYNRARQAAITQEITEIVAGANALQ

Source Source

Source organism organism	Bacillus sp. (strain PS3)
NCBI taxonomy ID ncbi_taxonomy_id	2334
Host organism host_organism	Escherichia coli

Entity 4 Entity 4 polymer

Description description	ATP synthase epsilon chain
Molecular weight formula_weight	14585.9 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

MKTIHVSVVTPDGPVYEDDVEMVSVKAKSGELGILPGHIPLVAPLEISAARLKKGGKTQYIAVSGGFLEVRPDKVTILAQAAERAEDIDVLRAKAAKERAERRLQSQQDDIDFKRAELALKRAMNRLSVAEMK

Source Source

Source organism organism	Bacillus sp. (strain PS3)
NCBI taxonomy ID ncbi_taxonomy_id	2334
Host organism host_organism	Escherichia coli

Entity 5 Entity 5 polymer

Description description	ATP synthase subunit delta
Molecular weight formula_weight	19790.7 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

MNQEVIAKRYASALFQIALEQGQLDRIEEDVRAVRQALAENGEFLSLLSYPKLSLDQKKALIAEAFAGVSTPVQNTLLLLLERHRFGLVPELAEQFLALVDDARGIAKAVAYSARPLTDEELRALSDVFAQKVGKQTLEIENIIDPELIGGVRLRIGNRIYDGSVSGQLERIRRQLIG

Source Source

Source organism organism	Bacillus sp. (strain PS3)
NCBI taxonomy ID ncbi_taxonomy_id	2334
Host organism host_organism	Escherichia coli

Entity 6 Entity 6 polymer

Description description	ATP synthase subunit b
Molecular weight formula_weight	18735.8 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	b2

EAAHGISGGTIIYQLLMFIILLALLRKFAWQPLMNIMKQREEHIANEIDQAEKRRQEAEKLLEEQRELMKQSRQEAQALIENARKLAEEQKEQIVASARAEAERVKETAKKEIEREKEQAMAALREQVASLSVLIASKVIXXXXXXXXXXXXXXXXXKDVQEVGGARM

Source Source

Source organism organism	Bacillus sp. (strain PS3)
NCBI taxonomy ID ncbi_taxonomy_id	2334
Host organism host_organism	Escherichia coli

Entity 7 Entity 7 polymer

Description description	ATP synthase subunit b
Molecular weight formula_weight	19380.3 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	b1

EAAHGISGGTIIYQLLMFIILLALLRKFAWQPLMNIMKQREEHIANEIDQAEKRRQEAEKLLEEQRELMKQSRQEAQALIENARKLAEEQKEQIVASARAEAERVKETAKKEIEREKEQAMAALREQVASLSVLIASKVIEKELTEQDQRKLIEAYIKDVQEVGGARM

Source Source

Source organism organism	Bacillus sp. (strain PS3)
NCBI taxonomy ID ncbi_taxonomy_id	2334
Host organism host_organism	Escherichia coli

Entity 8 Entity 8 polymer

Description description	ATP synthase subunit a
Molecular weight formula_weight	26449.3 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	a

MEHKAPLVEFLGLTFNLSDMLMITITCLIVFIIAVAATRSLQLRPTGMQNFMEWVFDFVRGIINSTMDWQTGGRFLTLGVTLIMYVFVANMLGLPFSVHVNGELWWKSPTADATVTLTLAVMVVALTHYYGVKMKGASDYLRDYTRPVAWLFPLKIIEEFANTLTLGLRLFGNIYAGEILLGLLASLGTHYGVLGAVGAAIPMMVWQAFSIFVGTIQAFIFTMLTMVYMAHKVSHDH

Source Source

Source organism organism	Bacillus sp. (strain PS3)
NCBI taxonomy ID ncbi_taxonomy_id	2334
Host organism host_organism	Escherichia coli

Entity 9 Entity 9 polymer

Description description	ATP synthase subunit c
Molecular weight formula_weight	7337.8 kDa
Source method src_method	man
Copy count entity_count	10

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	c0,c1,c2,c3,c4,c5,c6,c7,c8,c9

MSLGVLAAAIAVGLGALGAGIGNGLIVSRTIEGIARQPELRPVLQTTMFIGVALVEALPIIGVVFSFIYLGR

Source Source

Source organism organism	Bacillus sp. (strain PS3)
NCBI taxonomy ID ncbi_taxonomy_id	2334
Host organism host_organism	Escherichia coli

Entity 10 Entity 10 non-polymer

Description description	ADENOSINE-5'-TRIPHOSPHATE
Molecular weight formula_weight	507.2 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 11 Entity 11 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 12 Entity 12 non-polymer

Description description	PHOSPHATE ION
Molecular weight formula_weight	95.0 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 13 Entity 13 non-polymer

Description description	ADENOSINE-5'-DIPHOSPHATE
Molecular weight formula_weight	427.2 kDa
Source method src_method	syn
Copy count entity_count	1

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.000 Å
Low-resolution limit resolution_low	— Å
R factor r_factor	—
R_work r_work	—
R_free r_free	—

Resolution resolution	3.00 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	405432

Bacillus PS3 ATP synthase class 1

1. Protein Identity and Related Structures Protein Identity & Related Structures

ATP synthase subunit alpha

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

ATP synthase subunit beta

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

ATP synthase gamma chain

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

ATP synthase epsilon chain

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

ATP synthase subunit c

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6n2y__assembly_1__model_1

6n2y__assembly_1__model_1 | I(q)

6n2y__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (13)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 polymer

Polymer Polymer

Source Source

Entity 5 Entity 5 polymer

Polymer Polymer

Source Source

Entity 6 Entity 6 polymer

Polymer Polymer

Source Source

Entity 7 Entity 7 polymer

Polymer Polymer

Source Source

Entity 8 Entity 8 polymer

Polymer Polymer

Source Source

Entity 9 Entity 9 polymer

Polymer Polymer

Source Source