6o7u

Saccharomyces cerevisiae V-ATPase Stv1-VO

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

V-type proton ATPase subunit a, Golgi isoform

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 15	V0 assembly protein 1 × 1 （P53262） ;V-type proton ATPase subunit c'' ; × 1 （P23968） V-type proton ATPase subunit d × 1 （P32366） V-type proton ATPase subunit e × 1 （Q3E7B6） Putative protein YPR170W-B × 1 （P0C5R9） V-type proton ATPase subunit c × 8 （P25515） ;V-type proton ATPase subunit c' ; × 1 （P32842）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	STV1_YEAST
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain a； PDBConstruct 1–890； UniProt 1–890

V0 assembly protein 1

OrganismNot specified

UniProt P53262

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 15	V-type proton ATPase subunit a, Golgi isoform × 1 （P37296） ;V-type proton ATPase subunit c'' ; × 1 （P23968） V-type proton ATPase subunit d × 1 （P32366） V-type proton ATPase subunit e × 1 （Q3E7B6） Putative protein YPR170W-B × 1 （P0C5R9） V-type proton ATPase subunit c × 8 （P25515） ;V-type proton ATPase subunit c' ; × 1 （P32842）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	VOA1_YEAST
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain b； PDBConstruct 1–265； UniProt 1–265

;V-type proton ATPase subunit c'' ;

OrganismNot specified

UniProt P23968

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 15	V-type proton ATPase subunit a, Golgi isoform × 1 （P37296） V0 assembly protein 1 × 1 （P53262） V-type proton ATPase subunit d × 1 （P32366） V-type proton ATPase subunit e × 1 （Q3E7B6） Putative protein YPR170W-B × 1 （P0C5R9） V-type proton ATPase subunit c × 8 （P25515） ;V-type proton ATPase subunit c' ; × 1 （P32842）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	VATO_YEAST
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain c； PDBConstruct 1–213； UniProt 1–213

V-type proton ATPase subunit d

OrganismNot specified

UniProt P32366

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 15	V-type proton ATPase subunit a, Golgi isoform × 1 （P37296） V0 assembly protein 1 × 1 （P53262） ;V-type proton ATPase subunit c'' ; × 1 （P23968） V-type proton ATPase subunit e × 1 （Q3E7B6） Putative protein YPR170W-B × 1 （P0C5R9） V-type proton ATPase subunit c × 8 （P25515） ;V-type proton ATPase subunit c' ; × 1 （P32842）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	VA0D_YEAST
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain d； PDBConstruct 1–345； UniProt 1–345

V-type proton ATPase subunit e

OrganismNot specified

UniProt Q3E7B6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 15	V-type proton ATPase subunit a, Golgi isoform × 1 （P37296） V0 assembly protein 1 × 1 （P53262） ;V-type proton ATPase subunit c'' ; × 1 （P23968） V-type proton ATPase subunit d × 1 （P32366） Putative protein YPR170W-B × 1 （P0C5R9） V-type proton ATPase subunit c × 8 （P25515） ;V-type proton ATPase subunit c' ; × 1 （P32842）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	VA0E_YEAST
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain e； PDBConstruct 1–73； UniProt 1–73

Putative protein YPR170W-B

OrganismNot specified

UniProt P0C5R9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 15	V-type proton ATPase subunit a, Golgi isoform × 1 （P37296） V0 assembly protein 1 × 1 （P53262） ;V-type proton ATPase subunit c'' ; × 1 （P23968） V-type proton ATPase subunit d × 1 （P32366） V-type proton ATPase subunit e × 1 （Q3E7B6） V-type proton ATPase subunit c × 8 （P25515） ;V-type proton ATPase subunit c' ; × 1 （P32842）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	YP17B_YEAST
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain f； PDBConstruct 1–85； UniProt 1–85

V-type proton ATPase subunit c

OrganismNot specified

UniProt P25515

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 15	V-type proton ATPase subunit a, Golgi isoform × 1 （P37296） V0 assembly protein 1 × 1 （P53262） ;V-type proton ATPase subunit c'' ; × 1 （P23968） V-type proton ATPase subunit d × 1 （P32366） V-type proton ATPase subunit e × 1 （Q3E7B6） Putative protein YPR170W-B × 1 （P0C5R9） ;V-type proton ATPase subunit c' ; × 1 （P32842）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	VATL1_YEAST
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain g； PDBConstruct 1–160； UniProt 1–160 Author chain h； PDBConstruct 1–160； UniProt 1–160 Author chain i； PDBConstruct 1–160； UniProt 1–160 Author chain j； PDBConstruct 1–160； UniProt 1–160 Author chain k； PDBConstruct 1–160； UniProt 1–160 Author chain l； PDBConstruct 1–160； UniProt 1–160 Author chain m； PDBConstruct 1–160； UniProt 1–160 Author chain n； PDBConstruct 1–160； UniProt 1–160

;V-type proton ATPase subunit c' ;

OrganismNot specified

UniProt P32842

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 15	V-type proton ATPase subunit a, Golgi isoform × 1 （P37296） V0 assembly protein 1 × 1 （P53262） ;V-type proton ATPase subunit c'' ; × 1 （P23968） V-type proton ATPase subunit d × 1 （P32366） V-type proton ATPase subunit e × 1 （Q3E7B6） Putative protein YPR170W-B × 1 （P0C5R9） V-type proton ATPase subunit c × 8 （P25515）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	VATL2_YEAST
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain o； PDBConstruct 1–164； UniProt 1–164

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6o7u
Deposition date deposition_date	2019-03-08
Structure title title	Saccharomyces cerevisiae V-ATPase Stv1-VO
Keywords keywords	Proton pump, MEMBRANE PROTEIN; MEMBRANE PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6o7u__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6o7u__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6o7u__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	43.44 Å
Rg (electron density)	42.59 Å
Total Rg	43.03 Å
Atom count	21268
Residues	2832
Excluded volume	388500 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6o7u__assembly_1__model_1`	pentadecameric （15）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (8)

Entity 1 Entity 1 polymer

Description description	V-type proton ATPase subunit a, Golgi isoform
Molecular weight formula_weight	104481.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	a
Atom count atom_count	21268

MNQEEAIFRSADMTYVQLYIPLEVIREVTFLLGKMSVFMVMDLNKDLTAFQRGYVNQLRRFDEVERMVGFLNEVVEKHAAETWKYILHIDDEGNDIAQPDMADLINTMEPLSLENVNDMVKEITDCESRARQLDESLDSLRSKLNDLLEQRQVIFECSKFIEVNPGIAGRATNPEIEQEERDVDEFRMTPDDISETLSDAFSFDDETPQDRGALGNDLTRNQSVEDLSFLEQGYQHRYMITGSIRRTKVDILNRILWRLLRGNLIFQNFPIEEPLLEGKEKVEKDCFIIFTHGETLLKKVKRVIDSLNGKIVSLNTRSSELVDTLNRQIDDLQRILDTTEQTLHTELLVIHDQLPVWSAMTKREKYVYTTLNKFQQESQGLIAEGWVPSTELIHLQDSLKDYIETLGSEYSTVFNVILTNKLPPTYHRTNKFTQAFQSIVDAYGIATYKEINAGLATVVTFPFMFAIMFGDMGHGFILFLMALFLVLNERKFGAMHRDEIFDMAFTGRYVLLLMGAFSVYTGLLYNDIFSKSMTIFKSGWQWPSTFRKGESIEAKKTGVYPFGLDFAWHGTDNGLLFSNSYKMKLSILMGYAHMTYSFMFSYINYRAKNSKVDIIGNFIPGLVFMQSIFGYLSWAIVYKWSKDWIKDDKPAPGLLNMLINMFLAPGTIDDQLYSGQAKLQVVLLLAALVCVPWLLLYKPLTLRRLNKNGGGGRPHGYQSVGNIEHEEQIAQQRHSAEGFQGMIISDVASVADSINESVGGGEQGPFNFGDVMIHQVIHTIEFCLNCISHTASYLRLWALSLAHAQLSSVLWDMTISNAFSSKNSGSPLAVMKVVFLFAMWFVLTVCILVFMEGTSAMLHALRLHWVEAMSKFFEGEGYAYEPFSFRAIIEDYKDHDGDYKDHDIDYKDDDDK

Entity 2 Entity 2 polymer

Description description	V0 assembly protein 1
Molecular weight formula_weight	29694.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	b

MVFGQLYALFIFTLSCCISKTVQADSSKESSSFISFDKESNWDTISTISSTADVISSVDSAIAVFEFDNFSLLDNLMIDEEYPFFNRFFANDVSLTVHDDSPLNISQSLSPIMEQFTVDELPESASDLLYEYSLDDKSIVLFKFTSDAYDLKKLDEFIDSCLSFLEDKSGDNLTVVINSLGWAFEDEDGDDEYATEETLSHHDNNKGKEGDDDILSSIWTEGLLMCLIVSALLLFILIVALSWISNLDITYGALEKSTNPIKKNN

Entity 3 Entity 3 polymer

Description description	;V-type proton ATPase subunit c'' ;
Molecular weight formula_weight	22610.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	c

MNKESKDDDMSLGKFSFSHFLYYLVLIVVIVYGLYKLFTGHGSDINFGKFLLRTSPYMWANLGIALCVGLSVVGAAWGIFITGSSMIGAGVRAPRITTKNLISIIFCEVVAIYGLIIAIVFSSKLTVATAENMYSKSNLYTGYSLFWAGITVGASNLICGIAVGITGATAAISDAADSALFVKILVIEIFGSILGLLGLIVGLLMAGKASEFQ

Entity 4 Entity 4 polymer

Description description	V-type proton ATPase subunit d
Molecular weight formula_weight	39822.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	d

MEGVYFNIDNGFIEGVVRGYRNGLLSNNQYINLTQCDTLEDLKLQLSSTDYGNFLSSVSSESLTTSLIQEYASSKLYHEFNYIRDQSSGSTRKFMDYITYGYMIDNVALMITGTIHDRDKGEILQRCHPLGWFDTLPTLSVATDLESLYETVLVDTPLAPYFKNCFDTAEELDDMNIEIIRNKLYKAYLEDFYNFVTEEIPEPAKECMQTLLGFEADRRSINIALNSLQSSDIDPDLKSDLLPNIGKLYPLATFHLAQAQDFEGVRAALANVYEYRGFLETGNLEDHFYQLEMELCRDAFTQQFAISTVWAWMKSKEQEVRNITWIAECIAQNQRERINNYISVY

Entity 5 Entity 5 polymer

Description description	V-type proton ATPase subunit e
Molecular weight formula_weight	8387.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	e

MSSFYTVVGVFIVVSAMSVLFWIMAPKNNQAVWRSTVILTLAMMFLMWAITFLCQLHPLVAPRRSDLRPEFAE

Entity 6 Entity 6 polymer

Description description	Putative protein YPR170W-B
Molecular weight formula_weight	9369.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	f

MRPVVSTGKAWCCTVLSAFGVVILSVIAHLFNTNHESFVGSINDPEDGPAVAHTVYLAALVYLVFFVFCGFQVYLARRKPSIELR

Entity 7 Entity 7 polymer

Description description	V-type proton ATPase subunit c
Molecular weight formula_weight	16357.5 kDa
Source method src_method	nat
Copy count entity_count	8

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	g,h,i,j,k,l,m,n

MTELCPVYAPFFGAIGCASAIIFTSLGAAYGTAKSGVGICATCVLRPDLLFKNIVPVIMAGIIAIYGLVVSVLVCYSLGQKQALYTGFIQLGAGLSVGLSGLAAGFAIGIVGDAGVRGSSQQPRLFVGMILILIFAEVLGLYGLIVALLLNSRATQDVVC

Entity 8 Entity 8 polymer

Description description	;V-type proton ATPase subunit c' ;
Molecular weight formula_weight	17046.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	o

MSTQLASNIYAPLYAPFFGFAGCAAAMVLSCLGAAIGTAKSGIGIAGIGTFKPELIMKSLIPVVMSGILAIYGLVVAVLIAGNLSPTEDYTLFNGFMHLSCGLCVGFACLSSGYAIGMVGDVGVRKYMHQPRLFVGIVLILIFSEVLGLYGMIVALILNTRGSE

▼

6. Fold Classification (SCOP + CATH) 20 domains

SCOP 2.08 (19 domains)

Domain ID domain_id	d6o7ud_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.40 — V-type ATP synthase subunit C
Superfamily Superfamily superfamily	f.40.1 — V-type ATP synthase subunit C
Family Family family	f.40.1.1 — V-type ATP synthase subunit C

Domain ID domain_id	d6o7ug1
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.17 — Transmembrane helix hairpin
Superfamily Superfamily superfamily	f.17.1 — Rotary ATPase ring subunits
Family Family family	f.17.1.1 — F1F0 ATP synthase subunit C or V-type proton ATPase subunit c

Domain ID domain_id	d6o7ug2
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.17 — Transmembrane helix hairpin
Superfamily Superfamily superfamily	f.17.1 — Rotary ATPase ring subunits
Family Family family	f.17.1.0 — automated matches

Domain ID domain_id	d6o7uh1
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.17 — Transmembrane helix hairpin
Superfamily Superfamily superfamily	f.17.1 — Rotary ATPase ring subunits
Family Family family	f.17.1.1 — F1F0 ATP synthase subunit C or V-type proton ATPase subunit c

Domain ID domain_id	d6o7uh2
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.17 — Transmembrane helix hairpin
Superfamily Superfamily superfamily	f.17.1 — Rotary ATPase ring subunits
Family Family family	f.17.1.0 — automated matches

Domain ID domain_id	d6o7ui1
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.17 — Transmembrane helix hairpin
Superfamily Superfamily superfamily	f.17.1 — Rotary ATPase ring subunits
Family Family family	f.17.1.1 — F1F0 ATP synthase subunit C or V-type proton ATPase subunit c

Domain ID domain_id	d6o7ui2
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.17 — Transmembrane helix hairpin
Superfamily Superfamily superfamily	f.17.1 — Rotary ATPase ring subunits
Family Family family	f.17.1.0 — automated matches

Domain ID domain_id	d6o7uj1
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.17 — Transmembrane helix hairpin
Superfamily Superfamily superfamily	f.17.1 — Rotary ATPase ring subunits
Family Family family	f.17.1.1 — F1F0 ATP synthase subunit C or V-type proton ATPase subunit c

Domain ID domain_id	d6o7uj2
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.17 — Transmembrane helix hairpin
Superfamily Superfamily superfamily	f.17.1 — Rotary ATPase ring subunits
Family Family family	f.17.1.0 — automated matches

Domain ID domain_id	d6o7uk1
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.17 — Transmembrane helix hairpin
Superfamily Superfamily superfamily	f.17.1 — Rotary ATPase ring subunits
Family Family family	f.17.1.1 — F1F0 ATP synthase subunit C or V-type proton ATPase subunit c

Domain ID domain_id	d6o7uk2
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.17 — Transmembrane helix hairpin
Superfamily Superfamily superfamily	f.17.1 — Rotary ATPase ring subunits
Family Family family	f.17.1.0 — automated matches

Domain ID domain_id	d6o7ul1
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.17 — Transmembrane helix hairpin
Superfamily Superfamily superfamily	f.17.1 — Rotary ATPase ring subunits
Family Family family	f.17.1.1 — F1F0 ATP synthase subunit C or V-type proton ATPase subunit c

Domain ID domain_id	d6o7ul2
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.17 — Transmembrane helix hairpin
Superfamily Superfamily superfamily	f.17.1 — Rotary ATPase ring subunits
Family Family family	f.17.1.0 — automated matches

Domain ID domain_id	d6o7um1
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.17 — Transmembrane helix hairpin
Superfamily Superfamily superfamily	f.17.1 — Rotary ATPase ring subunits
Family Family family	f.17.1.1 — F1F0 ATP synthase subunit C or V-type proton ATPase subunit c

Domain ID domain_id	d6o7um2
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.17 — Transmembrane helix hairpin
Superfamily Superfamily superfamily	f.17.1 — Rotary ATPase ring subunits
Family Family family	f.17.1.0 — automated matches

Domain ID domain_id	d6o7un1
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.17 — Transmembrane helix hairpin
Superfamily Superfamily superfamily	f.17.1 — Rotary ATPase ring subunits
Family Family family	f.17.1.1 — F1F0 ATP synthase subunit C or V-type proton ATPase subunit c

Domain ID domain_id	d6o7un2
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.17 — Transmembrane helix hairpin
Superfamily Superfamily superfamily	f.17.1 — Rotary ATPase ring subunits
Family Family family	f.17.1.0 — automated matches

Domain ID domain_id	d6o7uo1
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.17 — Transmembrane helix hairpin
Superfamily Superfamily superfamily	f.17.1 — Rotary ATPase ring subunits
Family Family family	f.17.1.0 — automated matches

Domain ID domain_id	d6o7uo2
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.17 — Transmembrane helix hairpin
Superfamily Superfamily superfamily	f.17.1 — Rotary ATPase ring subunits
Family Family family	f.17.1.0 — automated matches

CATH v4.4 (1 domains)

Domain ID domain_id	6o7uc01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	120 — Four Helix Bundle (Hemerythrin (Met), subunit A)
Homologous superfamily homologous superfamily	610 — lithium bound rotor ring of v- atpase

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	1

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.10 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	163024

Saccharomyces cerevisiae V-ATPase Stv1-VO

1. Protein Identity and Related Structures Protein Identity & Related Structures

V-type proton ATPase subunit a, Golgi isoform

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

V0 assembly protein 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

;V-type proton ATPase subunit c'' ;

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

V-type proton ATPase subunit d

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

V-type proton ATPase subunit e

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Putative protein YPR170W-B

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

V-type proton ATPase subunit c

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

;V-type proton ATPase subunit c' ;

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6o7u__assembly_1__model_1

6o7u__assembly_1__model_1 | I(q)

6o7u__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (8)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer