SAXSdb — 6ox7

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Non-structural protein 1

Influenza A virus (strain A/Brevig Mission/1/1918 H1N1)

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	Phosphatidylinositol 3-kinase regulatory subunit beta × 1 （O00459） water × 2	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 2	Phosphatidylinositol 3-kinase regulatory subunit beta × 1 （O00459） water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NS1_I18A0
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–145； UniProt 86–230 Author chain B； PDBConstruct 1–145； UniProt 86–230

Phosphatidylinositol 3-kinase regulatory subunit beta

Homo sapiens

UniProt O00459

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	Non-structural protein 1 × 1 （Q99AU3） water × 2	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 2	Non-structural protein 1 × 1 （Q99AU3） water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	P85B_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain C； PDBConstruct 3–165； UniProt 435–597 Author chain D； PDBConstruct 3–165； UniProt 435–597

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6ox7
Deposition date deposition_date	2019-05-13
Structure title title	The complex of 1918 NS1-ED and the iSH2 domain of the human p85beta subunit of PI3K
Keywords keywords	NS1, p85-beta, PI3K, 1918, VIRAL PROTEIN; VIRAL PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6ox7__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6ox7__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6ox7__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	26.95 Å
Rg (electron density)	27.05 Å
Total Rg	27.37 Å
Atom count	2082
Residues	256
Excluded volume	36918 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6ox7__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`6ox7__assembly_2__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Non-structural protein 1
Molecular weight formula_weight	16424.0 kDa
Mutation mutation	W187R
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	4262

ASRYLTDMTLEEMSRDWFMLMPKQKVAGSLCIRMDQAIMDKNIILKANFSVIFDRLETLILLRAFTEEGAIVGEISPLPSLPGHTDEDVKNAVGVLIGGLERNDNTVRVSETLQRFAWRSSNENGRPPLPPKQKRKMARTIKSEV

Source Source

Source organism organism	Influenza A virus (strain A/Brevig Mission/1/1918 H1N1)
NCBI taxonomy ID ncbi_taxonomy_id	88776
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Phosphatidylinositol 3-kinase regulatory subunit beta
Molecular weight formula_weight	19893.4 kDa
Mutation mutation	C501S
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,D

GSKEDSVEAVGAQLKVYHQQYQDKSREYDQLYEEYTRTSQELQMKRTAIEAFNETIKIFEEQGQTQEKSSKEYLERFRREGNEKEMQRILLNSERLKSRIAEIHESRTKLEQQLRAQASDNREIDKRMNSLKPDLMQLRKIRDQYLVWLTQKGARQKKINEWLGI

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	31

▼

6. Fold Classification (SCOP + CATH) 6 domains

SCOP 2.08 (4 domains)

Domain ID domain_id	d6ox7a_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.299 — Ns1 effector domain-like
Superfamily Superfamily superfamily	d.299.1 — Ns1 effector domain-like
Family Family family	d.299.1.1 — Ns1 effector domain-like

Domain ID domain_id	d6ox7b_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.299 — Ns1 effector domain-like
Superfamily Superfamily superfamily	d.299.1 — Ns1 effector domain-like
Family Family family	d.299.1.1 — Ns1 effector domain-like

Domain ID domain_id	d6ox7d1
Class class	h — Coiled coil proteins
Fold Fold fold	h.4 — Antiparallel coiled-coil
Superfamily Superfamily superfamily	h.4.21 — Phosphatidylinositol 3-kinase regulatory subunit P85 inter-SH2 (iSH2) domain-like
Family Family family	h.4.21.1 — Phosphatidylinositol 3-kinase regulatory subunit P85 inter-SH2 domain-like

Domain ID domain_id	d6ox7d2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

CATH v4.4 (2 domains)

Domain ID domain_id	6ox7A00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	420 — Nucleotidyltransferase; domain 5
Homologous superfamily homologous superfamily	330 — Influenza virus non-structural protein, effector domain

Domain ID domain_id	6ox7B00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	420 — Nucleotidyltransferase; domain 5
Homologous superfamily homologous superfamily	330 — Influenza virus non-structural protein, effector domain

▶

Unit-cell length a length_a	60.980 Å
Unit-cell length b length_b	94.030 Å
Unit-cell length c length_c	67.220 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	105.31 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	4

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	—

Resolution resolution	2.750 Å
Low-resolution limit resolution_low	44.650 Å
R factor r_factor	0.2296
R_work r_work	0.2281
R_free r_free	0.2625

The complex of 1918 NS1-ED and the iSH2 domain of the human p85beta subunit of PI3K

1. Protein Identity and Related Structures Protein Identity & Related Structures

Non-structural protein 1

State in the Current Structure

Other States of the Same Protein in the Database

Phosphatidylinositol 3-kinase regulatory subunit beta

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6ox7__assembly_1__model_1

6ox7__assembly_1__model_1 | I(q)

6ox7__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 6 domains

SCOP 2.08 (4 domains)

CATH v4.4 (2 domains)

7. Citations (1)

The complex of 1918 NS1-ED and the iSH2 domain of the human p85beta subunit of PI3K

1. Protein Identity and Related Structures Protein Identity & Related Structures

Non-structural protein 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Phosphatidylinositol 3-kinase regulatory subunit beta

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6ox7__assembly_1__model_1

6ox7__assembly_1__model_1 | I(q)

6ox7__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 6 domains

SCOP 2.08 (4 domains)

CATH v4.4 (2 domains)

7. Citations (1)