6pbk

Archaellum periplasmic stator protein complex FlaF and FlaG from Sulfolobus acidocaldarius

Method: X-RAY DIFFRACTION

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Saci FlaG soluble domain

Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770)

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 4	Conserved flagellar protein F × 2 （Q4J9K8） DI(HYDROXYETHYL)ETHER × 6 SODIUM ION × 3 1,2-ETHANEDIOL × 2 IMIDAZOLE × 3 water × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q4J9K7_SULAC
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 16–135； UniProt 32–151 Author chain C； PDBConstruct 16–135； UniProt 32–151

Conserved flagellar protein F

Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770)

UniProt Q4J9K8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 4	Saci FlaG soluble domain × 2 （Q4J9K7） DI(HYDROXYETHYL)ETHER × 6 SODIUM ION × 3 1,2-ETHANEDIOL × 2 IMIDAZOLE × 3 water × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q4J9K8_SULAC
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 17–146； UniProt 35–164 Author chain D； PDBConstruct 17–146； UniProt 35–164

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6pbk
Deposition date deposition_date	2019-06-14
Structure title title	Archaellum periplasmic stator protein complex FlaF and FlaG from Sulfolobus acidocaldarius
Keywords keywords	beta-sandwich fold Archaellum assembly subunit Stator protein, MOTOR PROTEIN; MOTOR PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6pbk__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6pbk__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6pbk__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	25.43 Å
Rg (electron density)	24.49 Å
Total Rg	25.27 Å
Atom count	3908
Residues	490
Excluded volume	69848 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6pbk__assembly_1__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Description description	Saci FlaG soluble domain
Molecular weight formula_weight	14971.5 kDa
Mutation mutation	V118K
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,C
Atom count atom_count	4073

MGSSHHHHHHSQDPNSISTTMSSYSIQQSQKMLTQLQIDYATNTSSNTVVAYLHNVGETTISYLQNSVVYFGPNGQLQPVGYNSGSSPYWTVTSNSLQPGSKVKIIIYLSSPLSSNQYYTIQIVTPNGYTVSYMF

Source Source

Source organism organism	Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770)
NCBI taxonomy ID ncbi_taxonomy_id	330779
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Conserved flagellar protein F
Molecular weight formula_weight	16248.9 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,D

MGSSHHHHHHSQDPNSNQAQELNHELELEQLETKITVSSVSLTGSTLNVVLENNGSTNLYDFQGFSVIVQYYANISNISTFNLSLYNYTKNSNPSPYYWTINTPLLAPGSQATLTIILPYPPYPNTQATVVIVTNYGPSVIWRGSL

Source Source

Source organism organism	Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770)
NCBI taxonomy ID ncbi_taxonomy_id	330779
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 non-polymer

Description description	DI(HYDROXYETHYL)ETHER
Molecular weight formula_weight	106.1 kDa
Source method src_method	syn
Copy count entity_count	6

Entity 4 Entity 4 non-polymer

Description description	SODIUM ION
Molecular weight formula_weight	23.0 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 5 Entity 5 non-polymer

Description description	1,2-ETHANEDIOL
Molecular weight formula_weight	62.1 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 6 Entity 6 non-polymer

Description description	IMIDAZOLE
Molecular weight formula_weight	69.1 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 7 Entity 7 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	147

▶

Unit-cell length a length_a	120.038 Å
Unit-cell length b length_b	120.038 Å
Unit-cell length c length_c	152.138 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	120.00 °
Molecules per unit cell Z z_pdb	12

Space group space_group	P 61
Space-group number int_tables_number	169
Crystal system crystal_system	—

Resolution resolution	2.805 Å
Low-resolution limit resolution_low	39.292 Å
R factor r_factor	0.1728
R_work r_work	0.1713
R_free r_free	0.2021

Archaellum periplasmic stator protein complex FlaF and FlaG from Sulfolobus acidocaldarius

1. Protein Identity and Related Structures Protein Identity & Related Structures

Saci FlaG soluble domain

State in the Current Structure

Other States of the Same Protein in the Database

Conserved flagellar protein F

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6pbk__assembly_1__model_1

6pbk__assembly_1__model_1 | I(q)

6pbk__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 non-polymer

Entity 7 Entity 7 water

7. Citations (1)

Archaellum periplasmic stator protein complex FlaF and FlaG from Sulfolobus acidocaldarius

1. Protein Identity and Related Structures Protein Identity & Related Structures

Saci FlaG soluble domain

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Conserved flagellar protein F

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6pbk__assembly_1__model_1

6pbk__assembly_1__model_1 | I(q)

6pbk__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 non-polymer

Entity 7 Entity 7 water

7. Citations (1)