6pe4

Yeast Vo motor in complex with 1 VopQ molecule

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

V-type proton ATPase subunit a, vacuolar isoform

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 16	V0 assembly protein 1 × 1 （P53262） V-type proton ATPase subunit d × 1 （P32366） V-type proton ATPase subunit e × 1 （Q3E7B6） Uncharacterized protein YPR170W-B × 1 （P0C5R9） ;V-type proton ATPase subunit c'' ; × 1 （P23968） ;V-type proton ATPase subunit c' ; × 1 （P32842） V-type proton ATPase subunit c × 8 （P25515） Cation transporter × 1 （A0A0L7YPA6）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	VPH1_YEAST
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–840； UniProt 1–840

V0 assembly protein 1

OrganismNot specified

UniProt P53262

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 16	V-type proton ATPase subunit a, vacuolar isoform × 1 （P32563） V-type proton ATPase subunit d × 1 （P32366） V-type proton ATPase subunit e × 1 （Q3E7B6） Uncharacterized protein YPR170W-B × 1 （P0C5R9） ;V-type proton ATPase subunit c'' ; × 1 （P23968） ;V-type proton ATPase subunit c' ; × 1 （P32842） V-type proton ATPase subunit c × 8 （P25515） Cation transporter × 1 （A0A0L7YPA6）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	VOA1_YEAST
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–265； UniProt 1–265

V-type proton ATPase subunit d

OrganismNot specified

UniProt P32366

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 16	V-type proton ATPase subunit a, vacuolar isoform × 1 （P32563） V0 assembly protein 1 × 1 （P53262） V-type proton ATPase subunit e × 1 （Q3E7B6） Uncharacterized protein YPR170W-B × 1 （P0C5R9） ;V-type proton ATPase subunit c'' ; × 1 （P23968） ;V-type proton ATPase subunit c' ; × 1 （P32842） V-type proton ATPase subunit c × 8 （P25515） Cation transporter × 1 （A0A0L7YPA6）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	VA0D_YEAST
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain D； PDBConstruct 1–345； UniProt 1–345

V-type proton ATPase subunit e

OrganismNot specified

UniProt Q3E7B6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 16	V-type proton ATPase subunit a, vacuolar isoform × 1 （P32563） V0 assembly protein 1 × 1 （P53262） V-type proton ATPase subunit d × 1 （P32366） Uncharacterized protein YPR170W-B × 1 （P0C5R9） ;V-type proton ATPase subunit c'' ; × 1 （P23968） ;V-type proton ATPase subunit c' ; × 1 （P32842） V-type proton ATPase subunit c × 8 （P25515） Cation transporter × 1 （A0A0L7YPA6）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	VA0E_YEAST
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain E； PDBConstruct 1–73； UniProt 1–73

Uncharacterized protein YPR170W-B

OrganismNot specified

UniProt P0C5R9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 16	V-type proton ATPase subunit a, vacuolar isoform × 1 （P32563） V0 assembly protein 1 × 1 （P53262） V-type proton ATPase subunit d × 1 （P32366） V-type proton ATPase subunit e × 1 （Q3E7B6） ;V-type proton ATPase subunit c'' ; × 1 （P23968） ;V-type proton ATPase subunit c' ; × 1 （P32842） V-type proton ATPase subunit c × 8 （P25515） Cation transporter × 1 （A0A0L7YPA6）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	YP17B_YEAST
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain F； PDBConstruct 1–85； UniProt 1–85

;V-type proton ATPase subunit c'' ;

OrganismNot specified

UniProt P23968

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 16	V-type proton ATPase subunit a, vacuolar isoform × 1 （P32563） V0 assembly protein 1 × 1 （P53262） V-type proton ATPase subunit d × 1 （P32366） V-type proton ATPase subunit e × 1 （Q3E7B6） Uncharacterized protein YPR170W-B × 1 （P0C5R9） ;V-type proton ATPase subunit c' ; × 1 （P32842） V-type proton ATPase subunit c × 8 （P25515） Cation transporter × 1 （A0A0L7YPA6）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	VATO_YEAST
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain G； PDBConstruct 1–213； UniProt 1–213

;V-type proton ATPase subunit c' ;

OrganismNot specified

UniProt P32842

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 16	V-type proton ATPase subunit a, vacuolar isoform × 1 （P32563） V0 assembly protein 1 × 1 （P53262） V-type proton ATPase subunit d × 1 （P32366） V-type proton ATPase subunit e × 1 （Q3E7B6） Uncharacterized protein YPR170W-B × 1 （P0C5R9） ;V-type proton ATPase subunit c'' ; × 1 （P23968） V-type proton ATPase subunit c × 8 （P25515） Cation transporter × 1 （A0A0L7YPA6）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	VATL2_YEAST
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain H； PDBConstruct 1–164； UniProt 1–164

V-type proton ATPase subunit c

OrganismNot specified

UniProt P25515

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 16	V-type proton ATPase subunit a, vacuolar isoform × 1 （P32563） V0 assembly protein 1 × 1 （P53262） V-type proton ATPase subunit d × 1 （P32366） V-type proton ATPase subunit e × 1 （Q3E7B6） Uncharacterized protein YPR170W-B × 1 （P0C5R9） ;V-type proton ATPase subunit c'' ; × 1 （P23968） ;V-type proton ATPase subunit c' ; × 1 （P32842） Cation transporter × 1 （A0A0L7YPA6）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	VATL1_YEAST
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain I； PDBConstruct 1–160； UniProt 1–160 Author chain J； PDBConstruct 1–160； UniProt 1–160 Author chain K； PDBConstruct 1–160； UniProt 1–160 Author chain L； PDBConstruct 1–160； UniProt 1–160 Author chain M； PDBConstruct 1–160； UniProt 1–160 Author chain N； PDBConstruct 1–160； UniProt 1–160 Author chain O； PDBConstruct 1–160； UniProt 1–160 Author chain P； PDBConstruct 1–160； UniProt 1–160

Cation transporter

Vibrio parahaemolyticus

UniProt A0A0L7YPA6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 16	V-type proton ATPase subunit a, vacuolar isoform × 1 （P32563） V0 assembly protein 1 × 1 （P53262） V-type proton ATPase subunit d × 1 （P32366） V-type proton ATPase subunit e × 1 （Q3E7B6） Uncharacterized protein YPR170W-B × 1 （P0C5R9） ;V-type proton ATPase subunit c'' ; × 1 （P23968） ;V-type proton ATPase subunit c' ; × 1 （P32842） V-type proton ATPase subunit c × 8 （P25515）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A0L7YPA6_VIBPH
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain Q； PDBConstruct 22–513； UniProt 1–492

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6pe4
Deposition date deposition_date	2019-06-20
Structure title title	Yeast Vo motor in complex with 1 VopQ molecule
Keywords keywords	complex, TRANSPORT PROTEIN; TRANSPORT PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6pe4__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6pe4__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6pe4__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	48.99 Å
Rg (electron density)	48.06 Å
Total Rg	48.30 Å
Atom count	24914
Residues	3295
Excluded volume	452840 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6pe4__assembly_1__model_1`	hexadecameric （16）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (9)

Entity 1 Entity 1 polymer

Description description	V-type proton ATPase subunit a, vacuolar isoform
Molecular weight formula_weight	115126.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	24914

MAEKEEAIFRSAEMALVQFYIPQEISRDSAYTLGQLGLVQFRDLNSKVRAFQRTFVNEIRRLDNVERQYRYFYSLLKKHDIKLYEGDTDKYLDGSGELYVPPSGSVIDDYVRNASYLEERLIQMEDATDQIEVQKNDLEQYRFILQSGDEFFLKGDNTDSTSYMDEDMIDANGENIAAAIGASVNYVTGVIARDKVATLEQILWRVLRGNLFFKTVEIEQPVYDVKTREYKHKNAFIVFSHGDLIIKRIRKIAESLDANLYDVDSSNEGRSQQLAKVNKNLSDLYTVLKTTSTTLESELYAIAKELDSWFQDVTREKAIFEILNKSNYDTNRKILIAEGWIPRDELATLQARLGEMIARLGIDVPSIIQVLDTNHTPPTFHRTNKFTAGFQSICDCYGIAQYREINAGLPTIVTFPFMFAIMFGDMGHGFLMTLAALSLVLNEKKINKMKRGEIFDMAFTGRYIILLMGVFSMYTGFLYNDIFSKTMTIFKSGWKWPDHWKKGESITATSVGTYPIGLDWAWHGTENALLFSNSYKMKLSILMGFIHMTYSYFFSLANHLYFNSMIDIIGNFIPGLLFMQGIFGYLSVCIVYKWAVDWVKDGKPAPGLLNMLINMFLSPGTIDDELYPHQAKVQVFLLLMALVCIPWLLLVKPLHFKFTHKKKSHEPLPSTEADASSEDLEAQQLISAMDADDAEEEEVGSGSHGEDFGDIMIHQVIHTIEFCLNCVSHTASYLRLWALSLAHAQLSSVLWTMTIQIAFGFRGFVGVFMTVALFAMWFALTCAVLVLMEGTSAMLHSLRLHWVESMSKFFVGEGLPYEPFAFEYKDMEVAVASASSSASSSMEKRRWKKNFIAVSAANRFKKISSSGALDYDIPTTASENLYFQGELKTAALAQHDEAVDNFNKEQQNAFYEILHLPNLNEEQRNAFIQSLKDDPSQSANLLAEAKKLNDAQAPKVDNFNKEQQNAFYEILHLPNLNEEQRNAFIQSLKDDPSQSANLLAEAKKLNDAQAPK

Entity 2 Entity 2 polymer

Description description	V0 assembly protein 1
Molecular weight formula_weight	29694.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MVFGQLYALFIFTLSCCISKTVQADSSKESSSFISFDKESNWDTISTISSTADVISSVDSAIAVFEFDNFSLLDNLMIDEEYPFFNRFFANDVSLTVHDDSPLNISQSLSPIMEQFTVDELPESASDLLYEYSLDDKSIVLFKFTSDAYDLKKLDEFIDSCLSFLEDKSGDNLTVVINSLGWAFEDEDGDDEYATEETLSHHDNNKGKEGDDDILSSIWTEGLLMCLIVSALLLFILIVALSWISNLDITYGALEKSTNPIKKNN

Entity 3 Entity 3 polymer

Description description	V-type proton ATPase subunit d
Molecular weight formula_weight	39822.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

MEGVYFNIDNGFIEGVVRGYRNGLLSNNQYINLTQCDTLEDLKLQLSSTDYGNFLSSVSSESLTTSLIQEYASSKLYHEFNYIRDQSSGSTRKFMDYITYGYMIDNVALMITGTIHDRDKGEILQRCHPLGWFDTLPTLSVATDLESLYETVLVDTPLAPYFKNCFDTAEELDDMNIEIIRNKLYKAYLEDFYNFVTEEIPEPAKECMQTLLGFEADRRSINIALNSLQSSDIDPDLKSDLLPNIGKLYPLATFHLAQAQDFEGVRAALANVYEYRGFLETGNLEDHFYQLEMELCRDAFTQQFAISTVWAWMKSKEQEVRNITWIAECIAQNQRERINNYISVY

Entity 4 Entity 4 polymer

Description description	V-type proton ATPase subunit e
Molecular weight formula_weight	8387.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

MSSFYTVVGVFIVVSAMSVLFWIMAPKNNQAVWRSTVILTLAMMFLMWAITFLCQLHPLVAPRRSDLRPEFAE

Entity 5 Entity 5 polymer

Description description	Uncharacterized protein YPR170W-B
Molecular weight formula_weight	9369.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

MRPVVSTGKAWCCTVLSAFGVVILSVIAHLFNTNHESFVGSINDPEDGPAVAHTVYLAALVYLVFFVFCGFQVYLARRKPSIELR

Entity 6 Entity 6 polymer

Description description	;V-type proton ATPase subunit c'' ;
Molecular weight formula_weight	22610.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

MNKESKDDDMSLGKFSFSHFLYYLVLIVVIVYGLYKLFTGHGSDINFGKFLLRTSPYMWANLGIALCVGLSVVGAAWGIFITGSSMIGAGVRAPRITTKNLISIIFCEVVAIYGLIIAIVFSSKLTVATAENMYSKSNLYTGYSLFWAGITVGASNLICGIAVGITGATAAISDAADSALFVKILVIEIFGSILGLLGLIVGLLMAGKASEFQ

Entity 7 Entity 7 polymer

Description description	;V-type proton ATPase subunit c' ;
Molecular weight formula_weight	17046.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

MSTQLASNIYAPLYAPFFGFAGCAAAMVLSCLGAAIGTAKSGIGIAGIGTFKPELIMKSLIPVVMSGILAIYGLVVAVLIAGNLSPTEDYTLFNGFMHLSCGLCVGFACLSSGYAIGMVGDVGVRKYMHQPRLFVGIVLILIFSEVLGLYGMIVALILNTRGSE

Entity 8 Entity 8 polymer

Description description	V-type proton ATPase subunit c
Molecular weight formula_weight	16357.5 kDa
Source method src_method	nat
Copy count entity_count	8

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I,J,K,L,M,N,O,P

MTELCPVYAPFFGAIGCASAIIFTSLGAAYGTAKSGVGICATCVLRPDLLFKNIVPVIMAGIIAIYGLVVSVLVCYSLGQKQALYTGFIQLGAGLSVGLSGLAAGFAIGIVGDAGVRGSSQQPRLFVGMILILIFAEVLGLYGLIVALLLNSRATQDVVC

Entity 9 Entity 9 polymer

Description description	Cation transporter
Molecular weight formula_weight	55424.7 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Q

MGSSHHHHHHSQDLDEVDAGSMVNTTQKISQSPVPDLEQFRAIAAQKDDRVISKRGEVKEPSTFHKGHKFASVSEGVLRKKYTKFFQENIKTHLDLKQALLKEEKPETALLAYSLVSPSGYRGEPLTERKILEVVSLLDEVKVDGDTYQQLKNTFDSISKDPRMQVSLENQYPGKMDGFGAQLLEMGKEKLKGSGVNAAINLALPGVGLLVATGRELHKASVNGDAEAYHHQLEQISQLPGRDQRLSMPMQQTLAIGHAMLSAEGAVGATLGMATGGLGTFGVSSVATAGVTPIAKEAIGTALTTGIISGGGFVAGQAGAYGLNNEVQDQLKQGPMSGVLPRLEISNVKGDFTFSMQEPAAVRALMAYLGPKEDTSMSSPQAPKEAQEMEAARLTLKQMLGSSPNEHLVPDVDSLLKLSDEDMPSQTESTANGAFKKLLSEDWDWLMPAVRAMDKGEAGKINEKLTYKLPLDAANGRVYLDKSPNLSDAQLDALDKLGSPSQLRLMYLAEGWI

Source Source

Source organism organism	Vibrio parahaemolyticus
NCBI taxonomy ID ncbi_taxonomy_id	670
Host organism host_organism	Escherichia coli

▼

6. Fold Classification (SCOP + CATH) 19 domains

SCOP 2.08 (19 domains)

Domain ID domain_id	d6pe4d_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.40 — V-type ATP synthase subunit C
Superfamily Superfamily superfamily	f.40.1 — V-type ATP synthase subunit C
Family Family family	f.40.1.1 — V-type ATP synthase subunit C

Domain ID domain_id	d6pe4h1
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.17 — Transmembrane helix hairpin
Superfamily Superfamily superfamily	f.17.1 — Rotary ATPase ring subunits
Family Family family	f.17.1.0 — automated matches

Domain ID domain_id	d6pe4h2
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.17 — Transmembrane helix hairpin
Superfamily Superfamily superfamily	f.17.1 — Rotary ATPase ring subunits
Family Family family	f.17.1.0 — automated matches

Domain ID domain_id	d6pe4i1
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.17 — Transmembrane helix hairpin
Superfamily Superfamily superfamily	f.17.1 — Rotary ATPase ring subunits
Family Family family	f.17.1.1 — F1F0 ATP synthase subunit C or V-type proton ATPase subunit c

Domain ID domain_id	d6pe4i2
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.17 — Transmembrane helix hairpin
Superfamily Superfamily superfamily	f.17.1 — Rotary ATPase ring subunits
Family Family family	f.17.1.0 — automated matches

Domain ID domain_id	d6pe4j1
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.17 — Transmembrane helix hairpin
Superfamily Superfamily superfamily	f.17.1 — Rotary ATPase ring subunits
Family Family family	f.17.1.1 — F1F0 ATP synthase subunit C or V-type proton ATPase subunit c

Domain ID domain_id	d6pe4j2
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.17 — Transmembrane helix hairpin
Superfamily Superfamily superfamily	f.17.1 — Rotary ATPase ring subunits
Family Family family	f.17.1.0 — automated matches

Domain ID domain_id	d6pe4k1
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.17 — Transmembrane helix hairpin
Superfamily Superfamily superfamily	f.17.1 — Rotary ATPase ring subunits
Family Family family	f.17.1.1 — F1F0 ATP synthase subunit C or V-type proton ATPase subunit c

Domain ID domain_id	d6pe4k2
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.17 — Transmembrane helix hairpin
Superfamily Superfamily superfamily	f.17.1 — Rotary ATPase ring subunits
Family Family family	f.17.1.0 — automated matches

Domain ID domain_id	d6pe4l1
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.17 — Transmembrane helix hairpin
Superfamily Superfamily superfamily	f.17.1 — Rotary ATPase ring subunits
Family Family family	f.17.1.1 — F1F0 ATP synthase subunit C or V-type proton ATPase subunit c

Domain ID domain_id	d6pe4l2
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.17 — Transmembrane helix hairpin
Superfamily Superfamily superfamily	f.17.1 — Rotary ATPase ring subunits
Family Family family	f.17.1.0 — automated matches

Domain ID domain_id	d6pe4m1
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.17 — Transmembrane helix hairpin
Superfamily Superfamily superfamily	f.17.1 — Rotary ATPase ring subunits
Family Family family	f.17.1.1 — F1F0 ATP synthase subunit C or V-type proton ATPase subunit c

Domain ID domain_id	d6pe4m2
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.17 — Transmembrane helix hairpin
Superfamily Superfamily superfamily	f.17.1 — Rotary ATPase ring subunits
Family Family family	f.17.1.0 — automated matches

Domain ID domain_id	d6pe4n1
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.17 — Transmembrane helix hairpin
Superfamily Superfamily superfamily	f.17.1 — Rotary ATPase ring subunits
Family Family family	f.17.1.1 — F1F0 ATP synthase subunit C or V-type proton ATPase subunit c

Domain ID domain_id	d6pe4n2
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.17 — Transmembrane helix hairpin
Superfamily Superfamily superfamily	f.17.1 — Rotary ATPase ring subunits
Family Family family	f.17.1.0 — automated matches

Domain ID domain_id	d6pe4o1
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.17 — Transmembrane helix hairpin
Superfamily Superfamily superfamily	f.17.1 — Rotary ATPase ring subunits
Family Family family	f.17.1.1 — F1F0 ATP synthase subunit C or V-type proton ATPase subunit c

Domain ID domain_id	d6pe4o2
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.17 — Transmembrane helix hairpin
Superfamily Superfamily superfamily	f.17.1 — Rotary ATPase ring subunits
Family Family family	f.17.1.0 — automated matches

Domain ID domain_id	d6pe4p1
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.17 — Transmembrane helix hairpin
Superfamily Superfamily superfamily	f.17.1 — Rotary ATPase ring subunits
Family Family family	f.17.1.1 — F1F0 ATP synthase subunit C or V-type proton ATPase subunit c

Domain ID domain_id	d6pe4p2
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.17 — Transmembrane helix hairpin
Superfamily Superfamily superfamily	f.17.1 — Rotary ATPase ring subunits
Family Family family	f.17.1.0 — automated matches

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.10 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	108491

Yeast Vo motor in complex with 1 VopQ molecule

1. Protein Identity and Related Structures Protein Identity & Related Structures

V-type proton ATPase subunit a, vacuolar isoform

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

V0 assembly protein 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

V-type proton ATPase subunit d

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

V-type proton ATPase subunit e

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Uncharacterized protein YPR170W-B

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

;V-type proton ATPase subunit c'' ;

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

;V-type proton ATPase subunit c' ;

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

V-type proton ATPase subunit c

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cation transporter

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6pe4__assembly_1__model_1

6pe4__assembly_1__model_1 | I(q)

6pe4__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment