6q9b

CI Membrane Arm focused refinement from Ovine respiratory SC I+III2

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

NADH:ubiquinone oxidoreductase core subunit S2,NADH:ubiquinone oxidoreductase core subunit S2

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 29	NADH-ubiquinone oxidoreductase chain 3 × 1 （O78753） NADH-ubiquinone oxidoreductase chain 1 × 1 （O78747） NADH-ubiquinone oxidoreductase chain 6 × 1 （O78757） NADH-ubiquinone oxidoreductase chain 4L × 1 （O78754） NADH-ubiquinone oxidoreductase chain 5 × 1 （O78756） NADH-ubiquinone oxidoreductase chain 4 × 1 （O78755） NADH-ubiquinone oxidoreductase chain 2 × 1 （O78748） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （W5PAR2） NADH:ubiquinone oxidoreductase subunit B5 × 1 （W5QHN8） Acyl carrier protein × 1 （W5NQT7） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （W5PYA5） NADH:ubiquinone oxidoreductase subunit B10 × 1 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （W5QBF5） NADH:ubiquinone oxidoreductase subunit S5 × 1 （W5QFF9） NADH:ubiquinone oxidoreductase subunit A3 × 1 （W5NYM7） NADH:ubiquinone oxidoreductase subunit B3 × 1 （W5Q5T4） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （W5P9Q8） NADH:ubiquinone oxidoreductase subunit B4 × 1 （W5QF73） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （W5PZE3） NADH:ubiquinone oxidoreductase subunit B7 × 1 （W5P5V3） NADH:ubiquinone oxidoreductase subunit B9 × 1 （W5PGA3） NADH:ubiquinone oxidoreductase subunit B2 × 1 （W5PVD7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （W5Q1B0） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （W5PWF1） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （W5QG39） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 1,2-Distearoyl-sn-glycerophosphoethanolamine × 6 CARDIOLIPIN × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	W5PJ73_SHEEP
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain S2； PDBConstruct 19–430； UniProt 1–412

NADH-ubiquinone oxidoreductase chain 3

OrganismNot specified

UniProt O78753

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 29	NADH:ubiquinone oxidoreductase core subunit S2,NADH:ubiquinone oxidoreductase core subunit S2 × 1 （W5PJ73） NADH-ubiquinone oxidoreductase chain 1 × 1 （O78747） NADH-ubiquinone oxidoreductase chain 6 × 1 （O78757） NADH-ubiquinone oxidoreductase chain 4L × 1 （O78754） NADH-ubiquinone oxidoreductase chain 5 × 1 （O78756） NADH-ubiquinone oxidoreductase chain 4 × 1 （O78755） NADH-ubiquinone oxidoreductase chain 2 × 1 （O78748） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （W5PAR2） NADH:ubiquinone oxidoreductase subunit B5 × 1 （W5QHN8） Acyl carrier protein × 1 （W5NQT7） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （W5PYA5） NADH:ubiquinone oxidoreductase subunit B10 × 1 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （W5QBF5） NADH:ubiquinone oxidoreductase subunit S5 × 1 （W5QFF9） NADH:ubiquinone oxidoreductase subunit A3 × 1 （W5NYM7） NADH:ubiquinone oxidoreductase subunit B3 × 1 （W5Q5T4） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （W5P9Q8） NADH:ubiquinone oxidoreductase subunit B4 × 1 （W5QF73） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （W5PZE3） NADH:ubiquinone oxidoreductase subunit B7 × 1 （W5P5V3） NADH:ubiquinone oxidoreductase subunit B9 × 1 （W5PGA3） NADH:ubiquinone oxidoreductase subunit B2 × 1 （W5PVD7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （W5Q1B0） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （W5PWF1） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （W5QG39） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 1,2-Distearoyl-sn-glycerophosphoethanolamine × 6 CARDIOLIPIN × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NU3M_SHEEP
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain D3； PDBConstruct 1–115； UniProt 1–115

NADH-ubiquinone oxidoreductase chain 1

OrganismNot specified

UniProt O78747

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 29	NADH:ubiquinone oxidoreductase core subunit S2,NADH:ubiquinone oxidoreductase core subunit S2 × 1 （W5PJ73） NADH-ubiquinone oxidoreductase chain 3 × 1 （O78753） NADH-ubiquinone oxidoreductase chain 6 × 1 （O78757） NADH-ubiquinone oxidoreductase chain 4L × 1 （O78754） NADH-ubiquinone oxidoreductase chain 5 × 1 （O78756） NADH-ubiquinone oxidoreductase chain 4 × 1 （O78755） NADH-ubiquinone oxidoreductase chain 2 × 1 （O78748） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （W5PAR2） NADH:ubiquinone oxidoreductase subunit B5 × 1 （W5QHN8） Acyl carrier protein × 1 （W5NQT7） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （W5PYA5） NADH:ubiquinone oxidoreductase subunit B10 × 1 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （W5QBF5） NADH:ubiquinone oxidoreductase subunit S5 × 1 （W5QFF9） NADH:ubiquinone oxidoreductase subunit A3 × 1 （W5NYM7） NADH:ubiquinone oxidoreductase subunit B3 × 1 （W5Q5T4） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （W5P9Q8） NADH:ubiquinone oxidoreductase subunit B4 × 1 （W5QF73） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （W5PZE3） NADH:ubiquinone oxidoreductase subunit B7 × 1 （W5P5V3） NADH:ubiquinone oxidoreductase subunit B9 × 1 （W5PGA3） NADH:ubiquinone oxidoreductase subunit B2 × 1 （W5PVD7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （W5Q1B0） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （W5PWF1） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （W5QG39） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 1,2-Distearoyl-sn-glycerophosphoethanolamine × 6 CARDIOLIPIN × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NU1M_SHEEP
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain D1； PDBConstruct 1–318； UniProt 1–318

NADH-ubiquinone oxidoreductase chain 6

OrganismNot specified

UniProt O78757

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 29	NADH:ubiquinone oxidoreductase core subunit S2,NADH:ubiquinone oxidoreductase core subunit S2 × 1 （W5PJ73） NADH-ubiquinone oxidoreductase chain 3 × 1 （O78753） NADH-ubiquinone oxidoreductase chain 1 × 1 （O78747） NADH-ubiquinone oxidoreductase chain 4L × 1 （O78754） NADH-ubiquinone oxidoreductase chain 5 × 1 （O78756） NADH-ubiquinone oxidoreductase chain 4 × 1 （O78755） NADH-ubiquinone oxidoreductase chain 2 × 1 （O78748） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （W5PAR2） NADH:ubiquinone oxidoreductase subunit B5 × 1 （W5QHN8） Acyl carrier protein × 1 （W5NQT7） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （W5PYA5） NADH:ubiquinone oxidoreductase subunit B10 × 1 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （W5QBF5） NADH:ubiquinone oxidoreductase subunit S5 × 1 （W5QFF9） NADH:ubiquinone oxidoreductase subunit A3 × 1 （W5NYM7） NADH:ubiquinone oxidoreductase subunit B3 × 1 （W5Q5T4） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （W5P9Q8） NADH:ubiquinone oxidoreductase subunit B4 × 1 （W5QF73） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （W5PZE3） NADH:ubiquinone oxidoreductase subunit B7 × 1 （W5P5V3） NADH:ubiquinone oxidoreductase subunit B9 × 1 （W5PGA3） NADH:ubiquinone oxidoreductase subunit B2 × 1 （W5PVD7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （W5Q1B0） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （W5PWF1） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （W5QG39） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 1,2-Distearoyl-sn-glycerophosphoethanolamine × 6 CARDIOLIPIN × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NU6M_SHEEP
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D6； PDBConstruct 1–175； UniProt 1–175

NADH-ubiquinone oxidoreductase chain 4L

OrganismNot specified

UniProt O78754

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 29	NADH:ubiquinone oxidoreductase core subunit S2,NADH:ubiquinone oxidoreductase core subunit S2 × 1 （W5PJ73） NADH-ubiquinone oxidoreductase chain 3 × 1 （O78753） NADH-ubiquinone oxidoreductase chain 1 × 1 （O78747） NADH-ubiquinone oxidoreductase chain 6 × 1 （O78757） NADH-ubiquinone oxidoreductase chain 5 × 1 （O78756） NADH-ubiquinone oxidoreductase chain 4 × 1 （O78755） NADH-ubiquinone oxidoreductase chain 2 × 1 （O78748） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （W5PAR2） NADH:ubiquinone oxidoreductase subunit B5 × 1 （W5QHN8） Acyl carrier protein × 1 （W5NQT7） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （W5PYA5） NADH:ubiquinone oxidoreductase subunit B10 × 1 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （W5QBF5） NADH:ubiquinone oxidoreductase subunit S5 × 1 （W5QFF9） NADH:ubiquinone oxidoreductase subunit A3 × 1 （W5NYM7） NADH:ubiquinone oxidoreductase subunit B3 × 1 （W5Q5T4） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （W5P9Q8） NADH:ubiquinone oxidoreductase subunit B4 × 1 （W5QF73） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （W5PZE3） NADH:ubiquinone oxidoreductase subunit B7 × 1 （W5P5V3） NADH:ubiquinone oxidoreductase subunit B9 × 1 （W5PGA3） NADH:ubiquinone oxidoreductase subunit B2 × 1 （W5PVD7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （W5Q1B0） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （W5PWF1） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （W5QG39） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 1,2-Distearoyl-sn-glycerophosphoethanolamine × 6 CARDIOLIPIN × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NU4LM_SHEEP
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain 4L； PDBConstruct 1–98； UniProt 1–98

NADH-ubiquinone oxidoreductase chain 5

OrganismNot specified

UniProt O78756

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 29	NADH:ubiquinone oxidoreductase core subunit S2,NADH:ubiquinone oxidoreductase core subunit S2 × 1 （W5PJ73） NADH-ubiquinone oxidoreductase chain 3 × 1 （O78753） NADH-ubiquinone oxidoreductase chain 1 × 1 （O78747） NADH-ubiquinone oxidoreductase chain 6 × 1 （O78757） NADH-ubiquinone oxidoreductase chain 4L × 1 （O78754） NADH-ubiquinone oxidoreductase chain 4 × 1 （O78755） NADH-ubiquinone oxidoreductase chain 2 × 1 （O78748） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （W5PAR2） NADH:ubiquinone oxidoreductase subunit B5 × 1 （W5QHN8） Acyl carrier protein × 1 （W5NQT7） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （W5PYA5） NADH:ubiquinone oxidoreductase subunit B10 × 1 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （W5QBF5） NADH:ubiquinone oxidoreductase subunit S5 × 1 （W5QFF9） NADH:ubiquinone oxidoreductase subunit A3 × 1 （W5NYM7） NADH:ubiquinone oxidoreductase subunit B3 × 1 （W5Q5T4） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （W5P9Q8） NADH:ubiquinone oxidoreductase subunit B4 × 1 （W5QF73） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （W5PZE3） NADH:ubiquinone oxidoreductase subunit B7 × 1 （W5P5V3） NADH:ubiquinone oxidoreductase subunit B9 × 1 （W5PGA3） NADH:ubiquinone oxidoreductase subunit B2 × 1 （W5PVD7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （W5Q1B0） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （W5PWF1） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （W5QG39） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 1,2-Distearoyl-sn-glycerophosphoethanolamine × 6 CARDIOLIPIN × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NU5M_SHEEP
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain D5； PDBConstruct 1–606； UniProt 1–606

NADH-ubiquinone oxidoreductase chain 4

OrganismNot specified

UniProt O78755

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 29	NADH:ubiquinone oxidoreductase core subunit S2,NADH:ubiquinone oxidoreductase core subunit S2 × 1 （W5PJ73） NADH-ubiquinone oxidoreductase chain 3 × 1 （O78753） NADH-ubiquinone oxidoreductase chain 1 × 1 （O78747） NADH-ubiquinone oxidoreductase chain 6 × 1 （O78757） NADH-ubiquinone oxidoreductase chain 4L × 1 （O78754） NADH-ubiquinone oxidoreductase chain 5 × 1 （O78756） NADH-ubiquinone oxidoreductase chain 2 × 1 （O78748） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （W5PAR2） NADH:ubiquinone oxidoreductase subunit B5 × 1 （W5QHN8） Acyl carrier protein × 1 （W5NQT7） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （W5PYA5） NADH:ubiquinone oxidoreductase subunit B10 × 1 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （W5QBF5） NADH:ubiquinone oxidoreductase subunit S5 × 1 （W5QFF9） NADH:ubiquinone oxidoreductase subunit A3 × 1 （W5NYM7） NADH:ubiquinone oxidoreductase subunit B3 × 1 （W5Q5T4） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （W5P9Q8） NADH:ubiquinone oxidoreductase subunit B4 × 1 （W5QF73） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （W5PZE3） NADH:ubiquinone oxidoreductase subunit B7 × 1 （W5P5V3） NADH:ubiquinone oxidoreductase subunit B9 × 1 （W5PGA3） NADH:ubiquinone oxidoreductase subunit B2 × 1 （W5PVD7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （W5Q1B0） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （W5PWF1） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （W5QG39） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 1,2-Distearoyl-sn-glycerophosphoethanolamine × 6 CARDIOLIPIN × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NU4M_SHEEP
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain D4； PDBConstruct 1–459； UniProt 1–459

NADH-ubiquinone oxidoreductase chain 2

OrganismNot specified

UniProt O78748

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 29	NADH:ubiquinone oxidoreductase core subunit S2,NADH:ubiquinone oxidoreductase core subunit S2 × 1 （W5PJ73） NADH-ubiquinone oxidoreductase chain 3 × 1 （O78753） NADH-ubiquinone oxidoreductase chain 1 × 1 （O78747） NADH-ubiquinone oxidoreductase chain 6 × 1 （O78757） NADH-ubiquinone oxidoreductase chain 4L × 1 （O78754） NADH-ubiquinone oxidoreductase chain 5 × 1 （O78756） NADH-ubiquinone oxidoreductase chain 4 × 1 （O78755） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （W5PAR2） NADH:ubiquinone oxidoreductase subunit B5 × 1 （W5QHN8） Acyl carrier protein × 1 （W5NQT7） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （W5PYA5） NADH:ubiquinone oxidoreductase subunit B10 × 1 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （W5QBF5） NADH:ubiquinone oxidoreductase subunit S5 × 1 （W5QFF9） NADH:ubiquinone oxidoreductase subunit A3 × 1 （W5NYM7） NADH:ubiquinone oxidoreductase subunit B3 × 1 （W5Q5T4） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （W5P9Q8） NADH:ubiquinone oxidoreductase subunit B4 × 1 （W5QF73） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （W5PZE3） NADH:ubiquinone oxidoreductase subunit B7 × 1 （W5P5V3） NADH:ubiquinone oxidoreductase subunit B9 × 1 （W5PGA3） NADH:ubiquinone oxidoreductase subunit B2 × 1 （W5PVD7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （W5Q1B0） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （W5PWF1） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （W5QG39） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 1,2-Distearoyl-sn-glycerophosphoethanolamine × 6 CARDIOLIPIN × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NU2M_SHEEP
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain D2； PDBConstruct 1–347； UniProt 1–347

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11

OrganismNot specified

UniProt W5PAR2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 29	NADH:ubiquinone oxidoreductase core subunit S2,NADH:ubiquinone oxidoreductase core subunit S2 × 1 （W5PJ73） NADH-ubiquinone oxidoreductase chain 3 × 1 （O78753） NADH-ubiquinone oxidoreductase chain 1 × 1 （O78747） NADH-ubiquinone oxidoreductase chain 6 × 1 （O78757） NADH-ubiquinone oxidoreductase chain 4L × 1 （O78754） NADH-ubiquinone oxidoreductase chain 5 × 1 （O78756） NADH-ubiquinone oxidoreductase chain 4 × 1 （O78755） NADH-ubiquinone oxidoreductase chain 2 × 1 （O78748） NADH:ubiquinone oxidoreductase subunit B5 × 1 （W5QHN8） Acyl carrier protein × 1 （W5NQT7） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （W5PYA5） NADH:ubiquinone oxidoreductase subunit B10 × 1 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （W5QBF5） NADH:ubiquinone oxidoreductase subunit S5 × 1 （W5QFF9） NADH:ubiquinone oxidoreductase subunit A3 × 1 （W5NYM7） NADH:ubiquinone oxidoreductase subunit B3 × 1 （W5Q5T4） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （W5P9Q8） NADH:ubiquinone oxidoreductase subunit B4 × 1 （W5QF73） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （W5PZE3） NADH:ubiquinone oxidoreductase subunit B7 × 1 （W5P5V3） NADH:ubiquinone oxidoreductase subunit B9 × 1 （W5PGA3） NADH:ubiquinone oxidoreductase subunit B2 × 1 （W5PVD7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （W5Q1B0） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （W5PWF1） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （W5QG39） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 1,2-Distearoyl-sn-glycerophosphoethanolamine × 6 CARDIOLIPIN × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	W5PAR2_SHEEP
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain AK； PDBConstruct 1–140； UniProt 2–141

NADH:ubiquinone oxidoreductase subunit B5

OrganismNot specified

UniProt W5QHN8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 29	NADH:ubiquinone oxidoreductase core subunit S2,NADH:ubiquinone oxidoreductase core subunit S2 × 1 （W5PJ73） NADH-ubiquinone oxidoreductase chain 3 × 1 （O78753） NADH-ubiquinone oxidoreductase chain 1 × 1 （O78747） NADH-ubiquinone oxidoreductase chain 6 × 1 （O78757） NADH-ubiquinone oxidoreductase chain 4L × 1 （O78754） NADH-ubiquinone oxidoreductase chain 5 × 1 （O78756） NADH-ubiquinone oxidoreductase chain 4 × 1 （O78755） NADH-ubiquinone oxidoreductase chain 2 × 1 （O78748） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （W5PAR2） Acyl carrier protein × 1 （W5NQT7） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （W5PYA5） NADH:ubiquinone oxidoreductase subunit B10 × 1 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （W5QBF5） NADH:ubiquinone oxidoreductase subunit S5 × 1 （W5QFF9） NADH:ubiquinone oxidoreductase subunit A3 × 1 （W5NYM7） NADH:ubiquinone oxidoreductase subunit B3 × 1 （W5Q5T4） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （W5P9Q8） NADH:ubiquinone oxidoreductase subunit B4 × 1 （W5QF73） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （W5PZE3） NADH:ubiquinone oxidoreductase subunit B7 × 1 （W5P5V3） NADH:ubiquinone oxidoreductase subunit B9 × 1 （W5PGA3） NADH:ubiquinone oxidoreductase subunit B2 × 1 （W5PVD7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （W5Q1B0） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （W5PWF1） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （W5QG39） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 1,2-Distearoyl-sn-glycerophosphoethanolamine × 6 CARDIOLIPIN × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	W5QHN8_SHEEP
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain B5； PDBConstruct 1–143； UniProt 47–189

Acyl carrier protein

OrganismNot specified

UniProt W5NQT7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 29	NADH:ubiquinone oxidoreductase core subunit S2,NADH:ubiquinone oxidoreductase core subunit S2 × 1 （W5PJ73） NADH-ubiquinone oxidoreductase chain 3 × 1 （O78753） NADH-ubiquinone oxidoreductase chain 1 × 1 （O78747） NADH-ubiquinone oxidoreductase chain 6 × 1 （O78757） NADH-ubiquinone oxidoreductase chain 4L × 1 （O78754） NADH-ubiquinone oxidoreductase chain 5 × 1 （O78756） NADH-ubiquinone oxidoreductase chain 4 × 1 （O78755） NADH-ubiquinone oxidoreductase chain 2 × 1 （O78748） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （W5PAR2） NADH:ubiquinone oxidoreductase subunit B5 × 1 （W5QHN8） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （W5PYA5） NADH:ubiquinone oxidoreductase subunit B10 × 1 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （W5QBF5） NADH:ubiquinone oxidoreductase subunit S5 × 1 （W5QFF9） NADH:ubiquinone oxidoreductase subunit A3 × 1 （W5NYM7） NADH:ubiquinone oxidoreductase subunit B3 × 1 （W5Q5T4） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （W5P9Q8） NADH:ubiquinone oxidoreductase subunit B4 × 1 （W5QF73） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （W5PZE3） NADH:ubiquinone oxidoreductase subunit B7 × 1 （W5P5V3） NADH:ubiquinone oxidoreductase subunit B9 × 1 （W5PGA3） NADH:ubiquinone oxidoreductase subunit B2 × 1 （W5PVD7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （W5Q1B0） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （W5PWF1） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （W5QG39） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 1,2-Distearoyl-sn-glycerophosphoethanolamine × 6 CARDIOLIPIN × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	W5NQT7_SHEEP
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain AB； PDBConstruct 1–88； UniProt 70–157

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8

OrganismNot specified

UniProt W5PYA5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 29	NADH:ubiquinone oxidoreductase core subunit S2,NADH:ubiquinone oxidoreductase core subunit S2 × 1 （W5PJ73） NADH-ubiquinone oxidoreductase chain 3 × 1 （O78753） NADH-ubiquinone oxidoreductase chain 1 × 1 （O78747） NADH-ubiquinone oxidoreductase chain 6 × 1 （O78757） NADH-ubiquinone oxidoreductase chain 4L × 1 （O78754） NADH-ubiquinone oxidoreductase chain 5 × 1 （O78756） NADH-ubiquinone oxidoreductase chain 4 × 1 （O78755） NADH-ubiquinone oxidoreductase chain 2 × 1 （O78748） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （W5PAR2） NADH:ubiquinone oxidoreductase subunit B5 × 1 （W5QHN8） Acyl carrier protein × 1 （W5NQT7） NADH:ubiquinone oxidoreductase subunit B10 × 1 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （W5QBF5） NADH:ubiquinone oxidoreductase subunit S5 × 1 （W5QFF9） NADH:ubiquinone oxidoreductase subunit A3 × 1 （W5NYM7） NADH:ubiquinone oxidoreductase subunit B3 × 1 （W5Q5T4） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （W5P9Q8） NADH:ubiquinone oxidoreductase subunit B4 × 1 （W5QF73） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （W5PZE3） NADH:ubiquinone oxidoreductase subunit B7 × 1 （W5P5V3） NADH:ubiquinone oxidoreductase subunit B9 × 1 （W5PGA3） NADH:ubiquinone oxidoreductase subunit B2 × 1 （W5PVD7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （W5Q1B0） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （W5PWF1） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （W5QG39） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 1,2-Distearoyl-sn-glycerophosphoethanolamine × 6 CARDIOLIPIN × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	W5PYA5_SHEEP
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain A8； PDBConstruct 1–171； UniProt 2–172

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial

OrganismNot specified

UniProt W5QBF5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 29	NADH:ubiquinone oxidoreductase core subunit S2,NADH:ubiquinone oxidoreductase core subunit S2 × 1 （W5PJ73） NADH-ubiquinone oxidoreductase chain 3 × 1 （O78753） NADH-ubiquinone oxidoreductase chain 1 × 1 （O78747） NADH-ubiquinone oxidoreductase chain 6 × 1 （O78757） NADH-ubiquinone oxidoreductase chain 4L × 1 （O78754） NADH-ubiquinone oxidoreductase chain 5 × 1 （O78756） NADH-ubiquinone oxidoreductase chain 4 × 1 （O78755） NADH-ubiquinone oxidoreductase chain 2 × 1 （O78748） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （W5PAR2） NADH:ubiquinone oxidoreductase subunit B5 × 1 （W5QHN8） Acyl carrier protein × 1 （W5NQT7） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （W5PYA5） NADH:ubiquinone oxidoreductase subunit B10 × 1 NADH:ubiquinone oxidoreductase subunit S5 × 1 （W5QFF9） NADH:ubiquinone oxidoreductase subunit A3 × 1 （W5NYM7） NADH:ubiquinone oxidoreductase subunit B3 × 1 （W5Q5T4） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （W5P9Q8） NADH:ubiquinone oxidoreductase subunit B4 × 1 （W5QF73） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （W5PZE3） NADH:ubiquinone oxidoreductase subunit B7 × 1 （W5P5V3） NADH:ubiquinone oxidoreductase subunit B9 × 1 （W5PGA3） NADH:ubiquinone oxidoreductase subunit B2 × 1 （W5PVD7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （W5Q1B0） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （W5PWF1） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （W5QG39） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 1,2-Distearoyl-sn-glycerophosphoethanolamine × 6 CARDIOLIPIN × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	W5QBF5_SHEEP
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain AJ； PDBConstruct 1–320； UniProt 36–355

NADH:ubiquinone oxidoreductase subunit S5

OrganismNot specified

UniProt W5QFF9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 29	NADH:ubiquinone oxidoreductase core subunit S2,NADH:ubiquinone oxidoreductase core subunit S2 × 1 （W5PJ73） NADH-ubiquinone oxidoreductase chain 3 × 1 （O78753） NADH-ubiquinone oxidoreductase chain 1 × 1 （O78747） NADH-ubiquinone oxidoreductase chain 6 × 1 （O78757） NADH-ubiquinone oxidoreductase chain 4L × 1 （O78754） NADH-ubiquinone oxidoreductase chain 5 × 1 （O78756） NADH-ubiquinone oxidoreductase chain 4 × 1 （O78755） NADH-ubiquinone oxidoreductase chain 2 × 1 （O78748） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （W5PAR2） NADH:ubiquinone oxidoreductase subunit B5 × 1 （W5QHN8） Acyl carrier protein × 1 （W5NQT7） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （W5PYA5） NADH:ubiquinone oxidoreductase subunit B10 × 1 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （W5QBF5） NADH:ubiquinone oxidoreductase subunit A3 × 1 （W5NYM7） NADH:ubiquinone oxidoreductase subunit B3 × 1 （W5Q5T4） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （W5P9Q8） NADH:ubiquinone oxidoreductase subunit B4 × 1 （W5QF73） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （W5PZE3） NADH:ubiquinone oxidoreductase subunit B7 × 1 （W5P5V3） NADH:ubiquinone oxidoreductase subunit B9 × 1 （W5PGA3） NADH:ubiquinone oxidoreductase subunit B2 × 1 （W5PVD7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （W5Q1B0） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （W5PWF1） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （W5QG39） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 1,2-Distearoyl-sn-glycerophosphoethanolamine × 6 CARDIOLIPIN × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	W5QFF9_SHEEP
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain S5； PDBConstruct 1–105； UniProt 2–106

NADH:ubiquinone oxidoreductase subunit A3

OrganismNot specified

UniProt W5NYM7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 29	NADH:ubiquinone oxidoreductase core subunit S2,NADH:ubiquinone oxidoreductase core subunit S2 × 1 （W5PJ73） NADH-ubiquinone oxidoreductase chain 3 × 1 （O78753） NADH-ubiquinone oxidoreductase chain 1 × 1 （O78747） NADH-ubiquinone oxidoreductase chain 6 × 1 （O78757） NADH-ubiquinone oxidoreductase chain 4L × 1 （O78754） NADH-ubiquinone oxidoreductase chain 5 × 1 （O78756） NADH-ubiquinone oxidoreductase chain 4 × 1 （O78755） NADH-ubiquinone oxidoreductase chain 2 × 1 （O78748） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （W5PAR2） NADH:ubiquinone oxidoreductase subunit B5 × 1 （W5QHN8） Acyl carrier protein × 1 （W5NQT7） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （W5PYA5） NADH:ubiquinone oxidoreductase subunit B10 × 1 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （W5QBF5） NADH:ubiquinone oxidoreductase subunit S5 × 1 （W5QFF9） NADH:ubiquinone oxidoreductase subunit B3 × 1 （W5Q5T4） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （W5P9Q8） NADH:ubiquinone oxidoreductase subunit B4 × 1 （W5QF73） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （W5PZE3） NADH:ubiquinone oxidoreductase subunit B7 × 1 （W5P5V3） NADH:ubiquinone oxidoreductase subunit B9 × 1 （W5PGA3） NADH:ubiquinone oxidoreductase subunit B2 × 1 （W5PVD7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （W5Q1B0） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （W5PWF1） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （W5QG39） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 1,2-Distearoyl-sn-glycerophosphoethanolamine × 6 CARDIOLIPIN × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	W5NYM7_SHEEP
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain A3； PDBConstruct 1–83； UniProt 2–84

NADH:ubiquinone oxidoreductase subunit B3

OrganismNot specified

UniProt W5Q5T4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 29	NADH:ubiquinone oxidoreductase core subunit S2,NADH:ubiquinone oxidoreductase core subunit S2 × 1 （W5PJ73） NADH-ubiquinone oxidoreductase chain 3 × 1 （O78753） NADH-ubiquinone oxidoreductase chain 1 × 1 （O78747） NADH-ubiquinone oxidoreductase chain 6 × 1 （O78757） NADH-ubiquinone oxidoreductase chain 4L × 1 （O78754） NADH-ubiquinone oxidoreductase chain 5 × 1 （O78756） NADH-ubiquinone oxidoreductase chain 4 × 1 （O78755） NADH-ubiquinone oxidoreductase chain 2 × 1 （O78748） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （W5PAR2） NADH:ubiquinone oxidoreductase subunit B5 × 1 （W5QHN8） Acyl carrier protein × 1 （W5NQT7） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （W5PYA5） NADH:ubiquinone oxidoreductase subunit B10 × 1 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （W5QBF5） NADH:ubiquinone oxidoreductase subunit S5 × 1 （W5QFF9） NADH:ubiquinone oxidoreductase subunit A3 × 1 （W5NYM7） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （W5P9Q8） NADH:ubiquinone oxidoreductase subunit B4 × 1 （W5QF73） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （W5PZE3） NADH:ubiquinone oxidoreductase subunit B7 × 1 （W5P5V3） NADH:ubiquinone oxidoreductase subunit B9 × 1 （W5PGA3） NADH:ubiquinone oxidoreductase subunit B2 × 1 （W5PVD7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （W5Q1B0） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （W5PWF1） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （W5QG39） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 1,2-Distearoyl-sn-glycerophosphoethanolamine × 6 CARDIOLIPIN × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	W5Q5T4_SHEEP
Isoform	—
PDB entities	17
Chains and sequence ranges	Author chain B3； PDBConstruct 1–97； UniProt 2–98

NADH dehydrogenase [ubiquinone] 1 subunit C2

OrganismNot specified

UniProt W5P9Q8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 29	NADH:ubiquinone oxidoreductase core subunit S2,NADH:ubiquinone oxidoreductase core subunit S2 × 1 （W5PJ73） NADH-ubiquinone oxidoreductase chain 3 × 1 （O78753） NADH-ubiquinone oxidoreductase chain 1 × 1 （O78747） NADH-ubiquinone oxidoreductase chain 6 × 1 （O78757） NADH-ubiquinone oxidoreductase chain 4L × 1 （O78754） NADH-ubiquinone oxidoreductase chain 5 × 1 （O78756） NADH-ubiquinone oxidoreductase chain 4 × 1 （O78755） NADH-ubiquinone oxidoreductase chain 2 × 1 （O78748） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （W5PAR2） NADH:ubiquinone oxidoreductase subunit B5 × 1 （W5QHN8） Acyl carrier protein × 1 （W5NQT7） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （W5PYA5） NADH:ubiquinone oxidoreductase subunit B10 × 1 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （W5QBF5） NADH:ubiquinone oxidoreductase subunit S5 × 1 （W5QFF9） NADH:ubiquinone oxidoreductase subunit A3 × 1 （W5NYM7） NADH:ubiquinone oxidoreductase subunit B3 × 1 （W5Q5T4） NADH:ubiquinone oxidoreductase subunit B4 × 1 （W5QF73） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （W5PZE3） NADH:ubiquinone oxidoreductase subunit B7 × 1 （W5P5V3） NADH:ubiquinone oxidoreductase subunit B9 × 1 （W5PGA3） NADH:ubiquinone oxidoreductase subunit B2 × 1 （W5PVD7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （W5Q1B0） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （W5PWF1） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （W5QG39） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 1,2-Distearoyl-sn-glycerophosphoethanolamine × 6 CARDIOLIPIN × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	W5P9Q8_SHEEP
Isoform	—
PDB entities	18
Chains and sequence ranges	Author chain C2； PDBConstruct 1–120； UniProt 3–122

NADH:ubiquinone oxidoreductase subunit B4

OrganismNot specified

UniProt W5QF73

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 29	NADH:ubiquinone oxidoreductase core subunit S2,NADH:ubiquinone oxidoreductase core subunit S2 × 1 （W5PJ73） NADH-ubiquinone oxidoreductase chain 3 × 1 （O78753） NADH-ubiquinone oxidoreductase chain 1 × 1 （O78747） NADH-ubiquinone oxidoreductase chain 6 × 1 （O78757） NADH-ubiquinone oxidoreductase chain 4L × 1 （O78754） NADH-ubiquinone oxidoreductase chain 5 × 1 （O78756） NADH-ubiquinone oxidoreductase chain 4 × 1 （O78755） NADH-ubiquinone oxidoreductase chain 2 × 1 （O78748） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （W5PAR2） NADH:ubiquinone oxidoreductase subunit B5 × 1 （W5QHN8） Acyl carrier protein × 1 （W5NQT7） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （W5PYA5） NADH:ubiquinone oxidoreductase subunit B10 × 1 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （W5QBF5） NADH:ubiquinone oxidoreductase subunit S5 × 1 （W5QFF9） NADH:ubiquinone oxidoreductase subunit A3 × 1 （W5NYM7） NADH:ubiquinone oxidoreductase subunit B3 × 1 （W5Q5T4） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （W5P9Q8） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （W5PZE3） NADH:ubiquinone oxidoreductase subunit B7 × 1 （W5P5V3） NADH:ubiquinone oxidoreductase subunit B9 × 1 （W5PGA3） NADH:ubiquinone oxidoreductase subunit B2 × 1 （W5PVD7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （W5Q1B0） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （W5PWF1） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （W5QG39） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 1,2-Distearoyl-sn-glycerophosphoethanolamine × 6 CARDIOLIPIN × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	W5QF73_SHEEP
Isoform	—
PDB entities	19
Chains and sequence ranges	Author chain B4； PDBConstruct 1–128； UniProt 3–130

NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6

OrganismNot specified

UniProt W5PZE3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 29	NADH:ubiquinone oxidoreductase core subunit S2,NADH:ubiquinone oxidoreductase core subunit S2 × 1 （W5PJ73） NADH-ubiquinone oxidoreductase chain 3 × 1 （O78753） NADH-ubiquinone oxidoreductase chain 1 × 1 （O78747） NADH-ubiquinone oxidoreductase chain 6 × 1 （O78757） NADH-ubiquinone oxidoreductase chain 4L × 1 （O78754） NADH-ubiquinone oxidoreductase chain 5 × 1 （O78756） NADH-ubiquinone oxidoreductase chain 4 × 1 （O78755） NADH-ubiquinone oxidoreductase chain 2 × 1 （O78748） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （W5PAR2） NADH:ubiquinone oxidoreductase subunit B5 × 1 （W5QHN8） Acyl carrier protein × 1 （W5NQT7） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （W5PYA5） NADH:ubiquinone oxidoreductase subunit B10 × 1 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （W5QBF5） NADH:ubiquinone oxidoreductase subunit S5 × 1 （W5QFF9） NADH:ubiquinone oxidoreductase subunit A3 × 1 （W5NYM7） NADH:ubiquinone oxidoreductase subunit B3 × 1 （W5Q5T4） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （W5P9Q8） NADH:ubiquinone oxidoreductase subunit B4 × 1 （W5QF73） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 NADH:ubiquinone oxidoreductase subunit B7 × 1 （W5P5V3） NADH:ubiquinone oxidoreductase subunit B9 × 1 （W5PGA3） NADH:ubiquinone oxidoreductase subunit B2 × 1 （W5PVD7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （W5Q1B0） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （W5PWF1） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （W5QG39） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 1,2-Distearoyl-sn-glycerophosphoethanolamine × 6 CARDIOLIPIN × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	W5PZE3_SHEEP
Isoform	—
PDB entities	21
Chains and sequence ranges	Author chain B6； PDBConstruct 1–127； UniProt 2–128

NADH:ubiquinone oxidoreductase subunit B7

OrganismNot specified

UniProt W5P5V3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 29	NADH:ubiquinone oxidoreductase core subunit S2,NADH:ubiquinone oxidoreductase core subunit S2 × 1 （W5PJ73） NADH-ubiquinone oxidoreductase chain 3 × 1 （O78753） NADH-ubiquinone oxidoreductase chain 1 × 1 （O78747） NADH-ubiquinone oxidoreductase chain 6 × 1 （O78757） NADH-ubiquinone oxidoreductase chain 4L × 1 （O78754） NADH-ubiquinone oxidoreductase chain 5 × 1 （O78756） NADH-ubiquinone oxidoreductase chain 4 × 1 （O78755） NADH-ubiquinone oxidoreductase chain 2 × 1 （O78748） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （W5PAR2） NADH:ubiquinone oxidoreductase subunit B5 × 1 （W5QHN8） Acyl carrier protein × 1 （W5NQT7） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （W5PYA5） NADH:ubiquinone oxidoreductase subunit B10 × 1 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （W5QBF5） NADH:ubiquinone oxidoreductase subunit S5 × 1 （W5QFF9） NADH:ubiquinone oxidoreductase subunit A3 × 1 （W5NYM7） NADH:ubiquinone oxidoreductase subunit B3 × 1 （W5Q5T4） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （W5P9Q8） NADH:ubiquinone oxidoreductase subunit B4 × 1 （W5QF73） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （W5PZE3） NADH:ubiquinone oxidoreductase subunit B9 × 1 （W5PGA3） NADH:ubiquinone oxidoreductase subunit B2 × 1 （W5PVD7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （W5Q1B0） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （W5PWF1） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （W5QG39） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 1,2-Distearoyl-sn-glycerophosphoethanolamine × 6 CARDIOLIPIN × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	W5P5V3_SHEEP
Isoform	—
PDB entities	22
Chains and sequence ranges	Author chain B7； PDBConstruct 1–136； UniProt 2–137

NADH:ubiquinone oxidoreductase subunit B9

OrganismNot specified

UniProt W5PGA3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 29	NADH:ubiquinone oxidoreductase core subunit S2,NADH:ubiquinone oxidoreductase core subunit S2 × 1 （W5PJ73） NADH-ubiquinone oxidoreductase chain 3 × 1 （O78753） NADH-ubiquinone oxidoreductase chain 1 × 1 （O78747） NADH-ubiquinone oxidoreductase chain 6 × 1 （O78757） NADH-ubiquinone oxidoreductase chain 4L × 1 （O78754） NADH-ubiquinone oxidoreductase chain 5 × 1 （O78756） NADH-ubiquinone oxidoreductase chain 4 × 1 （O78755） NADH-ubiquinone oxidoreductase chain 2 × 1 （O78748） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （W5PAR2） NADH:ubiquinone oxidoreductase subunit B5 × 1 （W5QHN8） Acyl carrier protein × 1 （W5NQT7） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （W5PYA5） NADH:ubiquinone oxidoreductase subunit B10 × 1 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （W5QBF5） NADH:ubiquinone oxidoreductase subunit S5 × 1 （W5QFF9） NADH:ubiquinone oxidoreductase subunit A3 × 1 （W5NYM7） NADH:ubiquinone oxidoreductase subunit B3 × 1 （W5Q5T4） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （W5P9Q8） NADH:ubiquinone oxidoreductase subunit B4 × 1 （W5QF73） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （W5PZE3） NADH:ubiquinone oxidoreductase subunit B7 × 1 （W5P5V3） NADH:ubiquinone oxidoreductase subunit B2 × 1 （W5PVD7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （W5Q1B0） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （W5PWF1） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （W5QG39） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 1,2-Distearoyl-sn-glycerophosphoethanolamine × 6 CARDIOLIPIN × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	W5PGA3_SHEEP
Isoform	—
PDB entities	23
Chains and sequence ranges	Author chain B9； PDBConstruct 1–178； UniProt 2–179

NADH:ubiquinone oxidoreductase subunit B2

OrganismNot specified

UniProt W5PVD7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 29	NADH:ubiquinone oxidoreductase core subunit S2,NADH:ubiquinone oxidoreductase core subunit S2 × 1 （W5PJ73） NADH-ubiquinone oxidoreductase chain 3 × 1 （O78753） NADH-ubiquinone oxidoreductase chain 1 × 1 （O78747） NADH-ubiquinone oxidoreductase chain 6 × 1 （O78757） NADH-ubiquinone oxidoreductase chain 4L × 1 （O78754） NADH-ubiquinone oxidoreductase chain 5 × 1 （O78756） NADH-ubiquinone oxidoreductase chain 4 × 1 （O78755） NADH-ubiquinone oxidoreductase chain 2 × 1 （O78748） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （W5PAR2） NADH:ubiquinone oxidoreductase subunit B5 × 1 （W5QHN8） Acyl carrier protein × 1 （W5NQT7） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （W5PYA5） NADH:ubiquinone oxidoreductase subunit B10 × 1 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （W5QBF5） NADH:ubiquinone oxidoreductase subunit S5 × 1 （W5QFF9） NADH:ubiquinone oxidoreductase subunit A3 × 1 （W5NYM7） NADH:ubiquinone oxidoreductase subunit B3 × 1 （W5Q5T4） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （W5P9Q8） NADH:ubiquinone oxidoreductase subunit B4 × 1 （W5QF73） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （W5PZE3） NADH:ubiquinone oxidoreductase subunit B7 × 1 （W5P5V3） NADH:ubiquinone oxidoreductase subunit B9 × 1 （W5PGA3） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （W5Q1B0） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （W5PWF1） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （W5QG39） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 1,2-Distearoyl-sn-glycerophosphoethanolamine × 6 CARDIOLIPIN × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	W5PVD7_SHEEP
Isoform	—
PDB entities	24
Chains and sequence ranges	Author chain B2； PDBConstruct 1–72； UniProt 37–108

NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial

OrganismNot specified

UniProt W5Q1B0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 29	NADH:ubiquinone oxidoreductase core subunit S2,NADH:ubiquinone oxidoreductase core subunit S2 × 1 （W5PJ73） NADH-ubiquinone oxidoreductase chain 3 × 1 （O78753） NADH-ubiquinone oxidoreductase chain 1 × 1 （O78747） NADH-ubiquinone oxidoreductase chain 6 × 1 （O78757） NADH-ubiquinone oxidoreductase chain 4L × 1 （O78754） NADH-ubiquinone oxidoreductase chain 5 × 1 （O78756） NADH-ubiquinone oxidoreductase chain 4 × 1 （O78755） NADH-ubiquinone oxidoreductase chain 2 × 1 （O78748） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （W5PAR2） NADH:ubiquinone oxidoreductase subunit B5 × 1 （W5QHN8） Acyl carrier protein × 1 （W5NQT7） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （W5PYA5） NADH:ubiquinone oxidoreductase subunit B10 × 1 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （W5QBF5） NADH:ubiquinone oxidoreductase subunit S5 × 1 （W5QFF9） NADH:ubiquinone oxidoreductase subunit A3 × 1 （W5NYM7） NADH:ubiquinone oxidoreductase subunit B3 × 1 （W5Q5T4） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （W5P9Q8） NADH:ubiquinone oxidoreductase subunit B4 × 1 （W5QF73） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （W5PZE3） NADH:ubiquinone oxidoreductase subunit B7 × 1 （W5P5V3） NADH:ubiquinone oxidoreductase subunit B9 × 1 （W5PGA3） NADH:ubiquinone oxidoreductase subunit B2 × 1 （W5PVD7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （W5PWF1） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （W5QG39） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 1,2-Distearoyl-sn-glycerophosphoethanolamine × 6 CARDIOLIPIN × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	W5Q1B0_SHEEP
Isoform	—
PDB entities	25
Chains and sequence ranges	Author chain B8； PDBConstruct 1–158； UniProt 29–186

NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial

OrganismNot specified

UniProt W5PWF1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 29	NADH:ubiquinone oxidoreductase core subunit S2,NADH:ubiquinone oxidoreductase core subunit S2 × 1 （W5PJ73） NADH-ubiquinone oxidoreductase chain 3 × 1 （O78753） NADH-ubiquinone oxidoreductase chain 1 × 1 （O78747） NADH-ubiquinone oxidoreductase chain 6 × 1 （O78757） NADH-ubiquinone oxidoreductase chain 4L × 1 （O78754） NADH-ubiquinone oxidoreductase chain 5 × 1 （O78756） NADH-ubiquinone oxidoreductase chain 4 × 1 （O78755） NADH-ubiquinone oxidoreductase chain 2 × 1 （O78748） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （W5PAR2） NADH:ubiquinone oxidoreductase subunit B5 × 1 （W5QHN8） Acyl carrier protein × 1 （W5NQT7） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （W5PYA5） NADH:ubiquinone oxidoreductase subunit B10 × 1 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （W5QBF5） NADH:ubiquinone oxidoreductase subunit S5 × 1 （W5QFF9） NADH:ubiquinone oxidoreductase subunit A3 × 1 （W5NYM7） NADH:ubiquinone oxidoreductase subunit B3 × 1 （W5Q5T4） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （W5P9Q8） NADH:ubiquinone oxidoreductase subunit B4 × 1 （W5QF73） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （W5PZE3） NADH:ubiquinone oxidoreductase subunit B7 × 1 （W5P5V3） NADH:ubiquinone oxidoreductase subunit B9 × 1 （W5PGA3） NADH:ubiquinone oxidoreductase subunit B2 × 1 （W5PVD7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （W5Q1B0） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （W5QG39） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 1,2-Distearoyl-sn-glycerophosphoethanolamine × 6 CARDIOLIPIN × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	W5PWF1_SHEEP
Isoform	—
PDB entities	26
Chains and sequence ranges	Author chain BK； PDBConstruct 1–125； UniProt 30–154

NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1

OrganismNot specified

UniProt W5QG39

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 29	NADH:ubiquinone oxidoreductase core subunit S2,NADH:ubiquinone oxidoreductase core subunit S2 × 1 （W5PJ73） NADH-ubiquinone oxidoreductase chain 3 × 1 （O78753） NADH-ubiquinone oxidoreductase chain 1 × 1 （O78747） NADH-ubiquinone oxidoreductase chain 6 × 1 （O78757） NADH-ubiquinone oxidoreductase chain 4L × 1 （O78754） NADH-ubiquinone oxidoreductase chain 5 × 1 （O78756） NADH-ubiquinone oxidoreductase chain 4 × 1 （O78755） NADH-ubiquinone oxidoreductase chain 2 × 1 （O78748） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （W5PAR2） NADH:ubiquinone oxidoreductase subunit B5 × 1 （W5QHN8） Acyl carrier protein × 1 （W5NQT7） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （W5PYA5） NADH:ubiquinone oxidoreductase subunit B10 × 1 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （W5QBF5） NADH:ubiquinone oxidoreductase subunit S5 × 1 （W5QFF9） NADH:ubiquinone oxidoreductase subunit A3 × 1 （W5NYM7） NADH:ubiquinone oxidoreductase subunit B3 × 1 （W5Q5T4） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （W5P9Q8） NADH:ubiquinone oxidoreductase subunit B4 × 1 （W5QF73） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （W5PZE3） NADH:ubiquinone oxidoreductase subunit B7 × 1 （W5P5V3） NADH:ubiquinone oxidoreductase subunit B9 × 1 （W5PGA3） NADH:ubiquinone oxidoreductase subunit B2 × 1 （W5PVD7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （W5Q1B0） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （W5PWF1） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 1,2-Distearoyl-sn-glycerophosphoethanolamine × 6 CARDIOLIPIN × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	W5QG39_SHEEP
Isoform	—
PDB entities	28
Chains and sequence ranges	Author chain B1； PDBConstruct 1–57； UniProt 2–58

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6q9b
Deposition date deposition_date	2018-12-17
Structure title title	CI Membrane Arm focused refinement from Ovine respiratory SC I+III2
Keywords keywords	complex I, membrane arm, cellular respiration, mitochondria, ELECTRON TRANSPORT; ELECTRON TRANSPORT
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6q9b__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6q9b__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6q9b__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	60.84 Å
Rg (electron density)	60.83 Å
Total Rg	60.67 Å
Atom count	38012
Residues	4627
Excluded volume	689850 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6q9b__assembly_1__model_1`	29-meric （29）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (33)

Entity 1 Entity 1 polymer

Description description	NADH:ubiquinone oxidoreductase core subunit S2,NADH:ubiquinone oxidoreductase core subunit S2
Molecular weight formula_weight	49193.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	S2
Atom count atom_count	38012

ARQWQPDVEWAEQYGGAVMYPTKETAHWKPPPWNDVDPPKDTLVSNLTLNFGPQHPAAHGVLRLVMELSGEMVRKCDPHIGLLHRGTEKLIEYKTYLQALPYFDRLDYVSMMCNEQAYSLAVEKLLNIQPPPRAQWIRVLFGEITRLLNHIMAVTTHALDIGAMTPFFWMFEEREKMFEFYERVSGARMHAAYVRPGGVHQDLPLGLMDDIYEFSKNFSLRIDELEEMLTNNRIWRNRTVDIGVVTAEDALNYGFSGVMLRGSGIQWDLRKTQPYDVYDQVEFDVPIGSRGDCYDRYLCRVEEMRQSIRIISQCLNKMPPGEIKVDDAKVSPPKRAEMKTSMESLIHHFKLYTEGYQVPPGATYTAIEAPKGEFGVYLVSDGSSRPYRCKIKAPGFAHLAGLDKMSKGHMLADVVAIIGTQDIVFGEVDR

Entity 2 Entity 2 polymer

Description description	NADH-ubiquinone oxidoreductase chain 3
Molecular weight formula_weight	13106.5 kDa
EC 编号 ec_number	7.1.1.2
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D3

MNLMITLLTNFTLATLLVTIAFWLPQLNVYSEKTSPYECGFDPMGSARLPFSMKFFLVAITFLLFDLEIALLLPLPWASQTTNLNTMLTMALLLIFLLAVSLAYEWTQKGLEWTE

Entity 3 Entity 3 polymer

Description description	NADH-ubiquinone oxidoreductase chain 1
Molecular weight formula_weight	35884.9 kDa
EC 编号 ec_number	7.1.1.2
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D1

MFMINVLTLIIPILLAVAFLTLVERKVLGYMQFRKGPNVVGPYGLLQPIADAIKLFIKEPLRPATSSISMFILAPILALTLALTMWIPLPMPYPLINMNLGVLFMLAMSSLAVYSILWSGWASNSKYALIGALRAVAQTISYEVTLAIILLSVLLMNGSFTLSTLIITQEQVWLIFPAWPLAMMWFISTLAETNRAPFDLTEGESELVSGFNVEYAAGPFALFFMAEYANIIMMNIFTTTLFLGAFHNPYMPELYTINFTIKSLLLSITFLWIRASYPRFRYDQLMHLLWKNFLPLTLALCMWHVSLPILLSSIPPQT

Entity 4 Entity 4 polymer

Description description	NADH-ubiquinone oxidoreductase chain 6
Molecular weight formula_weight	19126.6 kDa
EC 编号 ec_number	7.1.1.2
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D6

MMTYIVFILSIIFVMGFVGFSSKPSPIYGGLGLIVSGGVGCGIVLNFGGSFLGLMVFLIYLGGMMVVFGYTTAMATEQYPEVWVSNKVVLGTFITGLLMEFLMVYYVLKDKEVEIVFKFNGMGDWVIYDTGDSGFFSEEAMGIAALYSYGTWLVIVTGWSLLIGVVVIMEITRGN

Entity 5 Entity 5 polymer

Description description	NADH-ubiquinone oxidoreductase chain 4L
Molecular weight formula_weight	10840.2 kDa
EC 编号 ec_number	7.1.1.2
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	4L

MSLVYMNIMMAFTVSLTGLLMYRSHLMSSLLCLEGMMLSLFILATLMILNSHFTLASMMPIILLVFAACEAALGLSLLVMVSNTYGTDYVQNLNLLQC

Entity 6 Entity 6 polymer

Description description	NADH-ubiquinone oxidoreductase chain 5
Molecular weight formula_weight	68410.9 kDa
EC 编号 ec_number	7.1.1.2
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D5

MNLFSSLTLVTLILLTMPIAAINFNTHKFTNYPLYVKTTISCAFITSMIPTMMFIHTGQEMIISNWHWLTIQTLKLSLSFKMDFFSMMFVPVALFVTWSIMEFSMWYMHSDPNINQFFKYLLLFLITMLILVTANNLFQLFIGWEGVGIMSFLLIGWWYGRTDANTAALQAILYNRIGDIGFILAMAWFLINLNTWDLQQIFMLNPNDSNLPLMGLILAATGKSAQFGLHPWLPSAMEGPTPVSALLHSSTMVVAGIFLLIRFYPLTENNKFGQSIMLCLGAMTTLFTAMCALTQNDIKKIIAFSTSSQLGLMMVTIGINQPHLAFLHICTHAFFKAMLFMCSGSIIHSLNDEQDIRKMGGLFKAMPFTTTALIIGSLALTGMPFLTGFYSKDLIIESANTSYTNAWALLMTLVATSFTAIYSTRIIFFALLGQPRFPTLININENNPFLINSIKRLLIGSLFAGFIISNNIPPMTIPQMTMPHYLKMTALTVTILGFILALEISNTTHYLKFNYPSNTFKFSNLLGYYPTIMHRLTPYMNLTMSQKSASSLLDLIWLETILPKTISLAQMKMSTTITSQKGLIKLYFLSFLITILISTTLLNFHE

Entity 7 Entity 7 polymer

Description description	NADH-ubiquinone oxidoreductase chain 4
Molecular weight formula_weight	52058.7 kDa
EC 编号 ec_number	7.1.1.2
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D4

MLKYIIPTMMLMPLTWLSKNSMIWINTTLHSLLISLTSLLLLNQFGDNSLNFSLTFFSDSLSTPLLILTMWLLPLMLMASQHHLSKENLARKKLFISMLILLQLFLIMTFTATELIFFYIMFEATLVPTLIIITRWGNQTERLNAGLYFLFYTLAGSLPLLVALIYIQNTMGSLNFLILQYWVQPMPNSWSNTFMWLACMMAFMVKMPLYGLHLWLPKAHVEAPIAGSMVLAAILLKLGGYGMMRITLLLNPITDFMAYPFIMLSLWGMIMTSSICLRQTDLKSLIAYSSVSHMALVIVAILIQTPWSYMGATALMIAHGLTSSMLFCLANSNYERVHSRTMILARGLQTLLPLMAAWWLLASLTNLALPPSINLIGELFVVMSTFSWSNITIILMGLNMVITALYSLYMLITTQRGKHTHHINNILPSFTRENALMSLHMLPLLLLSLNPKIILGPLY

Entity 8 Entity 8 polymer

Description description	NADH-ubiquinone oxidoreductase chain 2
Molecular weight formula_weight	39149.8 kDa
EC 编号 ec_number	7.1.1.2
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D2

MNPIILIIILMTVMLGTIIVMISTHWLLIWIGFEMNMLAIIPIMMKKHNPRATEASTKYFLTQSTASMLLMMAIIINLMFSGQWTVMKLFNPMASMLMTMALAMKLGMAPFHFWVPEVTQGIPLSSGLILLTWQKLAPMSVLYQILPSINLDLILTLSILSITIGGWGGLNQTQLRKIMAYSSIAHMGWMTAVLLYNPTMTLLNLIIYIIMTSTMFTLFMANSTTTTLSLSHTWNKAPIMTILVLITLLSMGGLPPLSGFMPKWMIIQEMTKNDSIILPTLMAITALLNLYFYMRLTYSTALTMFPSTNNMKMKWQFPTTKRMTLLPTMTVLSTMLLPLTPILSILE

Entity 9 Entity 9 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11
Molecular weight formula_weight	14610.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AK

AKTLLHQYWDIPEGTECHRKTYAATSIGGASGLVVSAYSVALKTPTSFLEGVARTGRYTFTAAAIGAIFGLTSCISAQVREKPDDPLNYLIGGCAGGLTLGARTRSYGIGAAACAYMGLTAALVKMGQLEGWKVFAEPKV

Entity 10 Entity 10 polymer

Description description	NADH:ubiquinone oxidoreductase subunit B5
Molecular weight formula_weight	16714.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B5

SGDHGKRLFIIKPSGFYDKRFLKLLRFYILLTGIPVVIGITLINVFIGEAELAEIPEGYVPEHWEYFKHPISRWIARTFFDAPEKNYERTMAILQIESEKAELRLKELEVRRLMRAKGDGPWFQYPTIDKALIDHSPKATPDN

Entity 11 Entity 11 polymer

Description description	Acyl carrier protein
Molecular weight formula_weight	10119.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AB

SDAPPLTLEGIKDRVLYVLKLYDKIDPEKLSVNSHFMKDLGLDSLDQVEIIMAMEDEFGFEIPDIDAEKLMCPQEIVDYIADKKDVYE

Entity 12 Entity 12 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8
Molecular weight formula_weight	20008.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A8

PGIVELPSLEDLKVQEVKVSSSVLKAAAHHYGAQCDKPNKEFMLCRWEEKDPRRCLEEGKLVNQCALEFFRQIKRHCAEPFTEYWTCIDYSGLQLFRRCRKEQAQFDKCVLDKLGWVRPDLGELSKVTKVKTDRPLPENPYHSRARPEPNPEVEGDLKPARHGSRLFFWTM

Entity 13 Entity 13 polymer

Description description	NADH:ubiquinone oxidoreductase subunit B10
Molecular weight formula_weight	20880.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BJ

PDSWDKDVYPEPPRRTPAPSPQTSLPNPITYLTKAFDLLVDRPVTLVREFIERQHAKNKYYYYHREFRRVPDITECHEKDVLCMFEAEMQWKRDYKVDQEIVNIIQERLKACQQREGESHRQNCAKELQQFTQVVKAYQDRYHDLGAHYSARKCLAKQKQRMLAERKATKEAAAA

Entity 14 Entity 14 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial
Molecular weight formula_weight	36803.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AJ

LQYGPLAYILGEKTTKKMTENSKLITVDGNICSGKSKLAKEVAEKLGLKHFPEAGIHYADSTTGDGKPLPVRFSGNCSLEKFYDDPKSNDGNSYRLQAWLYASRLLQYADALEHLLSTGQGVVLERSIYSDFVFLEAMYRQGFIRKQCVDHYNQVKKVTVCEYLPPHVVIYVDVPVSEVQSRIQKKGNPHEMKITSAYLQDIENVYKGTFLPEMSEKCEVLQYSAWEAEDAEKVVEDIQYLKYDKGPWLDQDDRKLHNLRMLVQDKLEVLNYTSIPVFLPEVTIGAHQSDRVFQEFTELPGRKYRAGYNEDVGDKWIWLK

Entity 15 Entity 15 polymer

Description description	NADH:ubiquinone oxidoreductase subunit S5
Molecular weight formula_weight	12474.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	S5

PFFDVQKKLGVDLDHWMTIQSAEQPHRIPARCHAFEKEWIECAHGIGSIRAEKECKIEFEDFRECLLRQKTMKRLNAIKRQRDKLIKEGKYTPPPHHSGQEDLRP

Entity 16 Entity 16 polymer

Description description	NADH:ubiquinone oxidoreductase subunit A3
Molecular weight formula_weight	9194.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A3

APRVAAFLKNVWAKEPVLVASFAIAGLAVILPTLSPYTKYSLMINRATPYNYPVPLRDDGNMPDVPSHPQDPQGPSLEWLKRL

Entity 17 Entity 17 polymer

Description description	NADH:ubiquinone oxidoreductase subunit B3
Molecular weight formula_weight	11015.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B3

AHGHGHEHGPSKMELPDYKQWKIEGTPLETVQEKLAARGLRDPWGRNEAWRYMGGFANNVSFVGALLKGFKWGFAAFVVAVGAEYYLESQKKDKKHH

Entity 18 Entity 18 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 subunit C2
Molecular weight formula_weight	14231.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C2

MMTGRQARAPLQFLPDEARSLPPPKLTDPRLAYIGFLGYCSGLIDNAIRRRPVLSAGLHRQFLYITSFVFVGYYLLKRQDYMYAVRDHDMFSYIKSHPEDFPEKDKKTYREVFEEFHPVR

Entity 19 Entity 19 polymer

Description description	NADH:ubiquinone oxidoreductase subunit B4
Molecular weight formula_weight	14976.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B4

SFPKYEPSRLASLPTTLDPAEYDISSETRKAQAERLAIRSRLKREYQLQYNDPSRRGVVEDPALIRWTCARSANVYPNFRPNTKTSLLGALFGIGPLIFWYYVFKTDRDRKEKLIQEGKLDRTFNISY

Entity 20 Entity 20 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13
Molecular weight formula_weight	16635.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AM

AASKVKQDMPPVGGYGPIDYKRNLPRRGLSGYSMFAVGIGALLFGYWSMMRWNRERRRLQIEDFEARIALMPLLQAEKDRRVLQMLRENLEEEATIMKDVPGWKVGESVFHTTRWVTPMMGELYGLRTGEEILSSTYGFIWYT

Entity 21 Entity 21 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6
Molecular weight formula_weight	15433.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B6

SGYTPDEKLRLQQLRELRRRWLKDQELSPREPVLPPRRVSPVERFWNKFLQDGALWKNVIYKTYRHSIFAFTHVLIPVWIIHYYLKYHVTTKPYTIVEKKPRIFPGDTILETGEVIPPMKEFPDQHH

Entity 22 Entity 22 polymer

Description description	NADH:ubiquinone oxidoreductase subunit B7
Molecular weight formula_weight	16282.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B7

GAHLARRYLGDASVEPEPLRMPTFPPDYGFPERKEREMVATQQEMNDAQLVLQQRDYCAHYLIRFLKCKRDSFPNFLACKHEQHDWDYCEHLDYVKRMKEFERERRLLQRKKRREQREADMAKGLGPGEVAPEVAL

Entity 23 Entity 23 polymer

Description description	NADH:ubiquinone oxidoreductase subunit B9
Molecular weight formula_weight	21648.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B9

AFLPSAAYLTHQQKVLQLYKRALRHLESRCVHRDKYRYFACLLRARFDEHKNEKDMVKATQLLREAEKEFWHGQHPQPYIFPESPGGTSYERYECYKVPEWCLDDWHPSEKAMYPDYFAKREQWKKLRRESWEREVKQLQEETPVGGPRTEALPPARKQGDLPPLWWHIVTRPRERPM

Entity 24 Entity 24 polymer

Description description	NADH:ubiquinone oxidoreductase subunit B2
Molecular weight formula_weight	8500.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B2

AGGGAHIEPRYRQFPQLTRSQVIQAEFFSATMWFWILWRFWHDSDAVLGHFPYPDPSQWTDEELGIPPDDED

Entity 25 Entity 25 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial
Molecular weight formula_weight	18818.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B8

ASHITKDMLPGPYPKTPEERAAAAKKYNMRVEDYEPYPDDGMGYGDYPKLPDRSQQERDPWYDWDHPDLRLNWGEPMHWDLDMYIRNRVDTSPTPVNWNLMCKHLFGFVAFMLFMFWVGETYPTYQPVGPKQYPYNNLYLERGGDPNKEPEPVVHYEI

Entity 26 Entity 26 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial
Molecular weight formula_weight	14455.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BK

ESSSSRAVIAPSTLAGKRPSEPTLRWQEDPEPEDENLYEKNPDSHGYDKDPAVDVWNMRVVFFFGFSIVLVLGSTFVAYLPDYRMQEWARREAERLVKYREAHGLPLMESNCFDPSKIQLPEDED

Entity 27 Entity 27 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial
Molecular weight formula_weight	5808.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C1

KFYIQEPPHGSPNWLKVGLTLGTSAFLWIYLIKQHNEDVLEYKRRNGLE

Entity 28 Entity 28 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1
Molecular weight formula_weight	6930.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B1

MNLLQVVRDHWIHVLVPVGFVFGYYLDRKNDEKLAAFRNKSLLYKRELKPNEEVTWK

Entity 29 Entity 29 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1
Molecular weight formula_weight	8211.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A1

MWFEVLPGIAVMGVCLFIPGMATARIHRFSNGGREKRVAHYSYQWYLMERDRRVSGVNRYYVSKGLENID

Entity 30 Entity 30 non-polymer

Description description	1,2-Distearoyl-sn-glycerophosphoethanolamine
Molecular weight formula_weight	748.1 kDa
Source method src_method	syn
Copy count entity_count	6

Entity 31 Entity 31 non-polymer

Description description	CARDIOLIPIN
Molecular weight formula_weight	1464.0 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 32 Entity 32 non-polymer

Description description	1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE
Molecular weight formula_weight	790.1 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 33 Entity 33 non-polymer

Description description	S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate
Molecular weight formula_weight	568.7 kDa
Source method src_method	syn
Copy count entity_count	1

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	1

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	triclinic

Resolution resolution	3.90 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	174334

CI Membrane Arm focused refinement from Ovine respiratory SC I+III2

1. Protein Identity and Related Structures Protein Identity & Related Structures

NADH:ubiquinone oxidoreductase core subunit S2,NADH:ubiquinone oxidoreductase core subunit S2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

NADH-ubiquinone oxidoreductase chain 3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

NADH-ubiquinone oxidoreductase chain 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

NADH-ubiquinone oxidoreductase chain 6

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

NADH-ubiquinone oxidoreductase chain 4L

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

NADH-ubiquinone oxidoreductase chain 5

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

NADH-ubiquinone oxidoreductase chain 4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

NADH-ubiquinone oxidoreductase chain 2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

NADH:ubiquinone oxidoreductase subunit B5

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer