SAXSdb — 6qta

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Midasin,Midasin

Chaetomium thermophilum var. thermophilum DSM 1495

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	Ribosome assembly protein 4 × 1 （G0SC29） MAGNESIUM ION × 1 SULFATE ION × 3 GLYCEROL × 7 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	G0SHE6_CHATD
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 2–45； UniProt 4690–4733 Author chain A； PDBConstruct 49–272； UniProt 4774–4997

Ribosome assembly protein 4

Chaetomium thermophilum var. thermophilum DSM 1495

UniProt G0SC29

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	Midasin,Midasin × 1 （G0SHE6） MAGNESIUM ION × 1 SULFATE ION × 3 GLYCEROL × 7 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NLE1_CHATD
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 10–108； UniProt 30–128

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6qta
Deposition date deposition_date	2019-02-22
Structure title title	Crystal structure of Rea1-MIDAS/Rsa4-UBL complex from Chaetomium thermophilum
Keywords keywords	ribosome biogenesis, integrin, midas, RIBOSOME; RIBOSOME
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6qta__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6qta__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6qta__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	23.31 Å
Rg (electron density)	22.20 Å
Total Rg	23.05 Å
Atom count	2895
Residues	359
Excluded volume	51470 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6qta__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Description description	Midasin,Midasin
Molecular weight formula_weight	31464.8 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	3140

MHISDEQLKRPLRDYGEALEMWSTFQTKTQALSQSLSSQLRLILTGSGIPSKRAYQILLCVDDSSSMSDDNRSTAGNLALESLVMVARALTVLEAGQIGVMGFGTDVFVAHALTDPPFTSQDAGARVLQQFTFRQDSTDMVLLLRRTIDHFREARLIQASSSRGGEDLWQLALILSDGLVQSRDHARLRPLLREAMEQRVMVVFIVMDDARSRKGHSVLELKEARFGPDGVPVIHRYLDSFPFPYYLIVHHLEDLPGALAALLRTWFAEVNSGSHHHHHH

Source Source

Source organism organism	Chaetomium thermophilum var. thermophilum DSM 1495
NCBI taxonomy ID ncbi_taxonomy_id	759272
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 2 Entity 2 polymer

Description description	Ribosome assembly protein 4
Molecular weight formula_weight	12323.8 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MKHHHHHHPMATDLGSFKANFIDSDGNQMTDVVEINFADATEKNISNLLNTLLGRDREEFTPYRFRIHIPGKDLIIDQYPNDLLSLLQKHGVTNPFETTITLSAEPQA

Source Source

Source organism organism	Chaetomium thermophilum var. thermophilum DSM 1495
NCBI taxonomy ID ncbi_taxonomy_id	759272
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 3 Entity 3 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 4 Entity 4 non-polymer

Description description	SULFATE ION
Molecular weight formula_weight	96.1 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 5 Entity 5 non-polymer

Description description	GLYCEROL
Molecular weight formula_weight	92.1 kDa
Source method src_method	syn
Copy count entity_count	7

Entity 6 Entity 6 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	219

▶

Unit-cell length a length_a	115.675 Å
Unit-cell length b length_b	115.675 Å
Unit-cell length c length_c	74.623 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	P 43 21 2
Space-group number int_tables_number	96
Crystal system crystal_system	—

Resolution resolution	1.890 Å
Low-resolution limit resolution_low	36.580 Å
R factor r_factor	0.1776
R_work r_work	0.1758
R_free r_free	0.2114

Crystal structure of Rea1-MIDAS/Rsa4-UBL complex from Chaetomium thermophilum

1. Protein Identity and Related Structures Protein Identity & Related Structures

Midasin,Midasin

State in the Current Structure

Other States of the Same Protein in the Database

Ribosome assembly protein 4

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6qta__assembly_1__model_1

6qta__assembly_1__model_1 | I(q)

6qta__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 water

7. Citations (1)

Crystal structure of Rea1-MIDAS/Rsa4-UBL complex from Chaetomium thermophilum

1. Protein Identity and Related Structures Protein Identity & Related Structures

Midasin,Midasin

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Ribosome assembly protein 4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6qta__assembly_1__model_1

6qta__assembly_1__model_1 | I(q)

6qta__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 water

7. Citations (1)