SAXSdb — 6rwy

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Protein MxiH

Shigella flexneri

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 33	Inner rod protein × 6 Inner rod protein × 5 Surface presentation of antigens protein SpaP × 5 （P0A1L3） Surface presentation of antigens protein SpaR × 1 （P0A1M6） Surface presentation of antigens protein SpaQ × 5 （P0A1M4）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MXIH_SHIFL
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain L； PDBConstruct 16–98； UniProt 1–83 Author chain M； PDBConstruct 16–98； UniProt 1–83 Author chain N； PDBConstruct 16–98； UniProt 1–83 Author chain O； PDBConstruct 16–98； UniProt 1–83 Author chain P； PDBConstruct 16–98； UniProt 1–83 Author chain Q； PDBConstruct 16–98； UniProt 1–83 Author chain R； PDBConstruct 16–98； UniProt 1–83 Author chain S； PDBConstruct 16–98； UniProt 1–83 Author chain T； PDBConstruct 16–98； UniProt 1–83 Author chain U； PDBConstruct 16–98； UniProt 1–83 Author chain V； PDBConstruct 16–98； UniProt 1–83

Surface presentation of antigens protein SpaP

OrganismNot specified

UniProt P0A1L3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 33	Inner rod protein × 6 Inner rod protein × 5 Protein MxiH × 11 （P0A223） Surface presentation of antigens protein SpaR × 1 （P0A1M6） Surface presentation of antigens protein SpaQ × 5 （P0A1M4）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SPAP_SHIFL
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain a； PDBConstruct 1–216； UniProt 1–216 Author chain b； PDBConstruct 1–216； UniProt 1–216 Author chain c； PDBConstruct 1–216； UniProt 1–216 Author chain d； PDBConstruct 1–216； UniProt 1–216 Author chain e； PDBConstruct 1–216； UniProt 1–216

Surface presentation of antigens protein SpaR

OrganismNot specified

UniProt P0A1M6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 33	Inner rod protein × 6 Inner rod protein × 5 Protein MxiH × 11 （P0A223） Surface presentation of antigens protein SpaP × 5 （P0A1L3） Surface presentation of antigens protein SpaQ × 5 （P0A1M4）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SPAR_SHIFL
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain f； PDBConstruct 1–256； UniProt 1–256

Surface presentation of antigens protein SpaQ

OrganismNot specified

UniProt P0A1M4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 33	Inner rod protein × 6 Inner rod protein × 5 Protein MxiH × 11 （P0A223） Surface presentation of antigens protein SpaP × 5 （P0A1L3） Surface presentation of antigens protein SpaR × 1 （P0A1M6）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SPAQ_SHIFL
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain g； PDBConstruct 1–86； UniProt 1–86 Author chain h； PDBConstruct 1–86； UniProt 1–86 Author chain i； PDBConstruct 1–86； UniProt 1–86 Author chain j； PDBConstruct 1–86； UniProt 1–86 Author chain k； PDBConstruct 1–86； UniProt 1–86

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6rwy
Deposition date deposition_date	2019-06-06
Structure title title	Export apparatus core and inner rod of the Shigella type 3 secretion system
Keywords keywords	type 3 secretion system, shigella, protein translocation, injectisome, PROTEIN TRANSPORT; PROTEIN TRANSPORT
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6rwy__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6rwy__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6rwy__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	54.33 Å
Rg (electron density)	55.54 Å
Total Rg	55.79 Å
Atom count	22743
Residues	3160
Excluded volume	408010 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6rwy__assembly_1__model_1`	33-meric （33）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Description description	Inner rod protein
Molecular weight formula_weight	5039.2 kDa
Source method src_method	nat
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,G,H,I,J,K
Atom count atom_count	22743

XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

Entity 2 Entity 2 polymer

Description description	Inner rod protein
Molecular weight formula_weight	6230.7 kDa
Source method src_method	nat
Copy count entity_count	5

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,C,D,E,F

XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

Entity 3 Entity 3 polymer

Description description	Protein MxiH
Molecular weight formula_weight	11060.3 kDa
Source method src_method	man
Copy count entity_count	11

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L,M,N,O,P,Q,R,S,T,U,V

MASWSHPQFEKIEGRMSVTVPNDDWTLSSLSETFDDGTQTLQGELTLALDKLAKNPSNPQLLAEYQSKLSEYTLYRNAQSNTVKVIKDVDAAIIQNFR

Source Source

Source organism organism	Shigella flexneri
NCBI taxonomy ID ncbi_taxonomy_id	623
Host organism host_organism	Shigella flexneri

Entity 4 Entity 4 polymer

Description description	Surface presentation of antigens protein SpaP
Molecular weight formula_weight	24215.6 kDa
Source method src_method	nat
Copy count entity_count	5

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	a,b,c,d,e

MLSDMSLIATLSFFTLLPFLVAAGTCYIKFSIVFVMVRNALGLQQVPSNMTLNGIALIMALFVMKPIIEAGYENYLNGPQKFDTISDIVRFSDSGLMEYKQYLKKHTDLELARFFQRSEEENADLKSAENNDYSLFSLLPAYALSEIKDAFKIGFYLYLPFVVVDLVISSILLALGMMMMSPITISVPIKLVLFVALDGWGILSKALIEQYINIPA

Entity 5 Entity 5 polymer

Description description	Surface presentation of antigens protein SpaR
Molecular weight formula_weight	28513.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	f

MDISSWFESIHVFLILLNGVFFRLAPLFFFLPFLNNGIISPSIRIPVIFLVASGLITSGKVDIGSSVFEHVYFLMFKEIIVGLLLSFCLSLPFWIFHAVGSIIDNQRGATLSSSIDPANGVDTSELAKFFNLFSAVVFLYSGGMVFILESIQLSYNICPLFSQCSFRISNILTFLTLLASQAVILASPVMIVLLLSEVLLGVLSRFAPQMNAFSVSLTIKSLLAIFIIFICSSTIYFSKVQFFLGEHKFFTNLFVR

Entity 6 Entity 6 polymer

Description description	Surface presentation of antigens protein SpaQ
Molecular weight formula_weight	9433.3 kDa
Source method src_method	nat
Copy count entity_count	5

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	g,h,i,j,k

MSDIVYMGNKALYLILIFSLWPVGIATVIGLSIGLLQTVTQLQEQTLPFGIKLIGVSISLLLLSGWYGEVLLSFCHEIMFLIKSGV

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	1

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	5.11 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	72298

Export apparatus core and inner rod of the Shigella type 3 secretion system

1. Protein Identity and Related Structures Protein Identity & Related Structures

Protein MxiH

State in the Current Structure

Other States of the Same Protein in the Database

Surface presentation of antigens protein SpaP

State in the Current Structure

Other States of the Same Protein in the Database

Surface presentation of antigens protein SpaR

State in the Current Structure

Other States of the Same Protein in the Database

Surface presentation of antigens protein SpaQ

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6rwy__assembly_1__model_1

6rwy__assembly_1__model_1 | I(q)

6rwy__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 polymer

Polymer Polymer

Entity 6 Entity 6 polymer

Polymer Polymer

7. Citations (1)

Export apparatus core and inner rod of the Shigella type 3 secretion system

1. Protein Identity and Related Structures Protein Identity & Related Structures

Protein MxiH

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Surface presentation of antigens protein SpaP

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Surface presentation of antigens protein SpaR

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Surface presentation of antigens protein SpaQ

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6rwy__assembly_1__model_1

6rwy__assembly_1__model_1 | I(q)

6rwy__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 polymer

Polymer Polymer

Entity 6 Entity 6 polymer

Polymer Polymer

7. Citations (1)