SAXSdb — 6s8c

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Genome polyprotein,Genome polyprotein

Tick-borne encephalitis virus

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein homooligomer	Homooligomer	Protein 3	water × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	POLG_TBEVW
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–404； UniProt 281–684 Author chain A； PDBConstruct 413–434； UniProt 707–728 Author chain B； PDBConstruct 1–404； UniProt 281–684 Author chain B； PDBConstruct 413–434； UniProt 707–728 Author chain C； PDBConstruct 1–404； UniProt 281–684 Author chain C； PDBConstruct 413–434； UniProt 707–728

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6s8c
Deposition date deposition_date	2019-07-09
Structure title title	Post-fusion conformation of the envelope protein of tick-borne encephalitis virus with longer stem
Keywords keywords	ENVELOPE PROTEIN, MEMBRANE FUSION, STEM, VIRUS/VIRAL PROTEIN, VIRAL PROTEIN; VIRAL PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6s8c__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6s8c__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6s8c__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	30.70 Å
Rg (electron density)	29.73 Å
Total Rg	30.61 Å
Atom count	7755
Residues	1019
Excluded volume	138010 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6s8c__assembly_1__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Description description	Genome polyprotein,Genome polyprotein
Molecular weight formula_weight	48939.2 kDa
EC 编号 ec_number	3.4.21.91,3.6.1.15,3.6.4.13,2.1.1.56,2.1.1.57,2.7.7.48,3.4.21.91,3.6.1.15,3.6.4.13,2.1.1.56,2.1.1.57,2.7.7.48
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C
Atom count atom_count	7833

SRCTHLENRDFVTGTQGTTRVTLVLELGGCVTITAEGKPSMDVWLDAIYQENPAKTREYCLHAKLSDTKVAARCPTMGPATLAEEHQGGTVCKRDQSDRGHGNHCGLFGKGSIVACVKAACEAKKKATGHVYDANKIVYTVKVEPHTGDYVAANETHSGRKTASFTISSEKTILTMGEYGDVSLLCRVASGVDLAQTVILELDKTVEHLPTAWQVHRDWFNDLALPWKHEGAQNWNNAERLVEFGAPHAVKMDVYNLGDQTGVLLKALAGVPVAHIEGTKYHLKSGHVTCEVGLEKLKMKGLTYTMCDKTKFTWKRAPTDSGHDTVVMEVTFSGTKPCRIPVRAVAHGSPDVNVAMLITPNPTIENNGGGFIEMQLPPGDNIIYVGELSHQWFQKGSSIGRVFQGGGSGGGSGGFLSSIGKAVHTVLGGAFNSIGPFEDDDDKAGWSHPQFEK

Source Source

Source organism organism	Tick-borne encephalitis virus
NCBI taxonomy ID ncbi_taxonomy_id	11084
Host organism host_organism	Drosophila melanogaster

Entity 2 Entity 2 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	78

▼

6. Fold Classification (SCOP + CATH) 6 domains

SCOP 2.08 (4 domains)

Domain ID domain_id	d6s8ca1
Class class	b — All beta proteins
Fold Fold fold	b.1 — Immunoglobulin-like beta-sandwich
Superfamily Superfamily superfamily	b.1.18 — E set domains
Family Family family	b.1.18.0 — automated matches

Domain ID domain_id	d6s8cb1
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.10 — Viral glycoprotein, central and dimerisation domains
Superfamily Superfamily superfamily	f.10.1 — Viral glycoprotein, central and dimerisation domains
Family Family family	f.10.1.0 — automated matches

Domain ID domain_id	d6s8cb2
Class class	b — All beta proteins
Fold Fold fold	b.1 — Immunoglobulin-like beta-sandwich
Superfamily Superfamily superfamily	b.1.18 — E set domains
Family Family family	b.1.18.0 — automated matches

Domain ID domain_id	d6s8cc1
Class class	b — All beta proteins
Fold Fold fold	b.1 — Immunoglobulin-like beta-sandwich
Superfamily Superfamily superfamily	b.1.18 — E set domains
Family Family family	b.1.18.0 — automated matches

CATH v4.4 (2 domains)

Domain ID domain_id	6s8cB01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	350 —

Domain ID domain_id	6s8cC01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	350 —

▶

Unit-cell length a length_a	169.435 Å
Unit-cell length b length_b	169.435 Å
Unit-cell length c length_c	123.567 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	120.00 °
Molecules per unit cell Z z_pdb	27

Space group space_group	H 3
Space-group number int_tables_number	146
Crystal system crystal_system	—

Resolution resolution	2.570 Å
Low-resolution limit resolution_low	48.910 Å
R factor r_factor	0.1840
R_work r_work	0.1820
R_free r_free	0.2170

Post-fusion conformation of the envelope protein of tick-borne encephalitis virus with longer stem

1. Protein Identity and Related Structures Protein Identity & Related Structures

Genome polyprotein,Genome polyprotein

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6s8c__assembly_1__model_1

6s8c__assembly_1__model_1 | I(q)

6s8c__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 water

6. Fold Classification (SCOP + CATH) 6 domains

SCOP 2.08 (4 domains)

CATH v4.4 (2 domains)

7. Citations (2)

Post-fusion conformation of the envelope protein of tick-borne encephalitis virus with longer stem

1. Protein Identity and Related Structures Protein Identity & Related Structures

Genome polyprotein,Genome polyprotein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6s8c__assembly_1__model_1

6s8c__assembly_1__model_1 | I(q)

6s8c__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 water

6. Fold Classification (SCOP + CATH) 6 domains

SCOP 2.08 (4 domains)

CATH v4.4 (2 domains)

7. Citations (2)