6swe

IC2 head of cryo-EM structure of a full archaeal ribosomal translation initiation complex devoid of aIF1 in P. abyssi

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

30S ribosomal protein S7

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 13 RNA 2	16S ribosomal RNA × 1 30S ribosomal protein S9 × 1 （Q9V195） 30S ribosomal protein S10 × 1 （Q9V0V6） 30S ribosomal protein S13 × 1 （Q9V1A0） 30S ribosomal protein S14 type Z × 1 （P62012） 30S ribosomal protein S17e × 1 （Q9V0G0） 30S ribosomal protein S19 × 1 （Q9V1T9） 30S ribosomal protein S19e × 1 （Q9V0G8） 30S ribosomal protein S28e × 1 （P61029） 30S ribosomal protein S27ae × 1 （P61238） 30S ribosomal protein S3 × 1 （Q9V1U1） 50S ribosomal protein L7Ae × 1 （P62008） initiator Met-tRNA fMet from E. coli (A1U72 variant) × 1 Translation initiation factor 1A × 1 （Q9V138） MAGNESIUM ION × 8 ZINC ION × 1 water × 3	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS7_PYRAB
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain H； PDBConstruct 1–215； UniProt 1–215

30S ribosomal protein S9

OrganismNot specified

UniProt Q9V195

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 13 RNA 2	16S ribosomal RNA × 1 30S ribosomal protein S7 × 1 （Q9V109） 30S ribosomal protein S10 × 1 （Q9V0V6） 30S ribosomal protein S13 × 1 （Q9V1A0） 30S ribosomal protein S14 type Z × 1 （P62012） 30S ribosomal protein S17e × 1 （Q9V0G0） 30S ribosomal protein S19 × 1 （Q9V1T9） 30S ribosomal protein S19e × 1 （Q9V0G8） 30S ribosomal protein S28e × 1 （P61029） 30S ribosomal protein S27ae × 1 （P61238） 30S ribosomal protein S3 × 1 （Q9V1U1） 50S ribosomal protein L7Ae × 1 （P62008） initiator Met-tRNA fMet from E. coli (A1U72 variant) × 1 Translation initiation factor 1A × 1 （Q9V138） MAGNESIUM ION × 8 ZINC ION × 1 water × 3	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS9_PYRAB
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain K； PDBConstruct 1–135； UniProt 1–135

30S ribosomal protein S10

OrganismNot specified

UniProt Q9V0V6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 13 RNA 2	16S ribosomal RNA × 1 30S ribosomal protein S7 × 1 （Q9V109） 30S ribosomal protein S9 × 1 （Q9V195） 30S ribosomal protein S13 × 1 （Q9V1A0） 30S ribosomal protein S14 type Z × 1 （P62012） 30S ribosomal protein S17e × 1 （Q9V0G0） 30S ribosomal protein S19 × 1 （Q9V1T9） 30S ribosomal protein S19e × 1 （Q9V0G8） 30S ribosomal protein S28e × 1 （P61029） 30S ribosomal protein S27ae × 1 （P61238） 30S ribosomal protein S3 × 1 （Q9V1U1） 50S ribosomal protein L7Ae × 1 （P62008） initiator Met-tRNA fMet from E. coli (A1U72 variant) × 1 Translation initiation factor 1A × 1 （Q9V138） MAGNESIUM ION × 8 ZINC ION × 1 water × 3	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS10_PYRAB
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain L； PDBConstruct 1–102； UniProt 1–102

30S ribosomal protein S13

OrganismNot specified

UniProt Q9V1A0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 13 RNA 2	16S ribosomal RNA × 1 30S ribosomal protein S7 × 1 （Q9V109） 30S ribosomal protein S9 × 1 （Q9V195） 30S ribosomal protein S10 × 1 （Q9V0V6） 30S ribosomal protein S14 type Z × 1 （P62012） 30S ribosomal protein S17e × 1 （Q9V0G0） 30S ribosomal protein S19 × 1 （Q9V1T9） 30S ribosomal protein S19e × 1 （Q9V0G8） 30S ribosomal protein S28e × 1 （P61029） 30S ribosomal protein S27ae × 1 （P61238） 30S ribosomal protein S3 × 1 （Q9V1U1） 50S ribosomal protein L7Ae × 1 （P62008） initiator Met-tRNA fMet from E. coli (A1U72 variant) × 1 Translation initiation factor 1A × 1 （Q9V138） MAGNESIUM ION × 8 ZINC ION × 1 water × 3	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS13_PYRAB
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain O； PDBConstruct 1–148； UniProt 1–148

30S ribosomal protein S14 type Z

OrganismNot specified

UniProt P62012

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 13 RNA 2	16S ribosomal RNA × 1 30S ribosomal protein S7 × 1 （Q9V109） 30S ribosomal protein S9 × 1 （Q9V195） 30S ribosomal protein S10 × 1 （Q9V0V6） 30S ribosomal protein S13 × 1 （Q9V1A0） 30S ribosomal protein S17e × 1 （Q9V0G0） 30S ribosomal protein S19 × 1 （Q9V1T9） 30S ribosomal protein S19e × 1 （Q9V0G8） 30S ribosomal protein S28e × 1 （P61029） 30S ribosomal protein S27ae × 1 （P61238） 30S ribosomal protein S3 × 1 （Q9V1U1） 50S ribosomal protein L7Ae × 1 （P62008） initiator Met-tRNA fMet from E. coli (A1U72 variant) × 1 Translation initiation factor 1A × 1 （Q9V138） MAGNESIUM ION × 8 ZINC ION × 1 water × 3	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS14Z_PYRAB
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain P； PDBConstruct 1–56； UniProt 1–56

30S ribosomal protein S17e

OrganismNot specified

UniProt Q9V0G0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 13 RNA 2	16S ribosomal RNA × 1 30S ribosomal protein S7 × 1 （Q9V109） 30S ribosomal protein S9 × 1 （Q9V195） 30S ribosomal protein S10 × 1 （Q9V0V6） 30S ribosomal protein S13 × 1 （Q9V1A0） 30S ribosomal protein S14 type Z × 1 （P62012） 30S ribosomal protein S19 × 1 （Q9V1T9） 30S ribosomal protein S19e × 1 （Q9V0G8） 30S ribosomal protein S28e × 1 （P61029） 30S ribosomal protein S27ae × 1 （P61238） 30S ribosomal protein S3 × 1 （Q9V1U1） 50S ribosomal protein L7Ae × 1 （P62008） initiator Met-tRNA fMet from E. coli (A1U72 variant) × 1 Translation initiation factor 1A × 1 （Q9V138） MAGNESIUM ION × 8 ZINC ION × 1 water × 3	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS17E_PYRAB
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain S； PDBConstruct 1–67； UniProt 1–67

30S ribosomal protein S19

OrganismNot specified

UniProt Q9V1T9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 13 RNA 2	16S ribosomal RNA × 1 30S ribosomal protein S7 × 1 （Q9V109） 30S ribosomal protein S9 × 1 （Q9V195） 30S ribosomal protein S10 × 1 （Q9V0V6） 30S ribosomal protein S13 × 1 （Q9V1A0） 30S ribosomal protein S14 type Z × 1 （P62012） 30S ribosomal protein S17e × 1 （Q9V0G0） 30S ribosomal protein S19e × 1 （Q9V0G8） 30S ribosomal protein S28e × 1 （P61029） 30S ribosomal protein S27ae × 1 （P61238） 30S ribosomal protein S3 × 1 （Q9V1U1） 50S ribosomal protein L7Ae × 1 （P62008） initiator Met-tRNA fMet from E. coli (A1U72 variant) × 1 Translation initiation factor 1A × 1 （Q9V138） MAGNESIUM ION × 8 ZINC ION × 1 water × 3	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS19_PYRAB
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain T； PDBConstruct 1–132； UniProt 1–132

30S ribosomal protein S19e

OrganismNot specified

UniProt Q9V0G8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 13 RNA 2	16S ribosomal RNA × 1 30S ribosomal protein S7 × 1 （Q9V109） 30S ribosomal protein S9 × 1 （Q9V195） 30S ribosomal protein S10 × 1 （Q9V0V6） 30S ribosomal protein S13 × 1 （Q9V1A0） 30S ribosomal protein S14 type Z × 1 （P62012） 30S ribosomal protein S17e × 1 （Q9V0G0） 30S ribosomal protein S19 × 1 （Q9V1T9） 30S ribosomal protein S28e × 1 （P61029） 30S ribosomal protein S27ae × 1 （P61238） 30S ribosomal protein S3 × 1 （Q9V1U1） 50S ribosomal protein L7Ae × 1 （P62008） initiator Met-tRNA fMet from E. coli (A1U72 variant) × 1 Translation initiation factor 1A × 1 （Q9V138） MAGNESIUM ION × 8 ZINC ION × 1 water × 3	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS19E_PYRAB
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain U； PDBConstruct 1–150； UniProt 1–150

30S ribosomal protein S28e

OrganismNot specified

UniProt P61029

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 13 RNA 2	16S ribosomal RNA × 1 30S ribosomal protein S7 × 1 （Q9V109） 30S ribosomal protein S9 × 1 （Q9V195） 30S ribosomal protein S10 × 1 （Q9V0V6） 30S ribosomal protein S13 × 1 （Q9V1A0） 30S ribosomal protein S14 type Z × 1 （P62012） 30S ribosomal protein S17e × 1 （Q9V0G0） 30S ribosomal protein S19 × 1 （Q9V1T9） 30S ribosomal protein S19e × 1 （Q9V0G8） 30S ribosomal protein S27ae × 1 （P61238） 30S ribosomal protein S3 × 1 （Q9V1U1） 50S ribosomal protein L7Ae × 1 （P62008） initiator Met-tRNA fMet from E. coli (A1U72 variant) × 1 Translation initiation factor 1A × 1 （Q9V138） MAGNESIUM ION × 8 ZINC ION × 1 water × 3	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS28_PYRAB
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain X； PDBConstruct 1–71； UniProt 1–71

30S ribosomal protein S27ae

OrganismNot specified

UniProt P61238

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 13 RNA 2	16S ribosomal RNA × 1 30S ribosomal protein S7 × 1 （Q9V109） 30S ribosomal protein S9 × 1 （Q9V195） 30S ribosomal protein S10 × 1 （Q9V0V6） 30S ribosomal protein S13 × 1 （Q9V1A0） 30S ribosomal protein S14 type Z × 1 （P62012） 30S ribosomal protein S17e × 1 （Q9V0G0） 30S ribosomal protein S19 × 1 （Q9V1T9） 30S ribosomal protein S19e × 1 （Q9V0G8） 30S ribosomal protein S28e × 1 （P61029） 30S ribosomal protein S3 × 1 （Q9V1U1） 50S ribosomal protein L7Ae × 1 （P62008） initiator Met-tRNA fMet from E. coli (A1U72 variant) × 1 Translation initiation factor 1A × 1 （Q9V138） MAGNESIUM ION × 8 ZINC ION × 1 water × 3	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS27A_PYRAB
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain Y； PDBConstruct 1–51； UniProt 1–51

30S ribosomal protein S3

OrganismNot specified

UniProt Q9V1U1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 13 RNA 2	16S ribosomal RNA × 1 30S ribosomal protein S7 × 1 （Q9V109） 30S ribosomal protein S9 × 1 （Q9V195） 30S ribosomal protein S10 × 1 （Q9V0V6） 30S ribosomal protein S13 × 1 （Q9V1A0） 30S ribosomal protein S14 type Z × 1 （P62012） 30S ribosomal protein S17e × 1 （Q9V0G0） 30S ribosomal protein S19 × 1 （Q9V1T9） 30S ribosomal protein S19e × 1 （Q9V0G8） 30S ribosomal protein S28e × 1 （P61029） 30S ribosomal protein S27ae × 1 （P61238） 50S ribosomal protein L7Ae × 1 （P62008） initiator Met-tRNA fMet from E. coli (A1U72 variant) × 1 Translation initiation factor 1A × 1 （Q9V138） MAGNESIUM ION × 8 ZINC ION × 1 water × 3	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS3_PYRAB
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain Z； PDBConstruct 1–210； UniProt 1–210

50S ribosomal protein L7Ae

OrganismNot specified

UniProt P62008

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 13 RNA 2	16S ribosomal RNA × 1 30S ribosomal protein S7 × 1 （Q9V109） 30S ribosomal protein S9 × 1 （Q9V195） 30S ribosomal protein S10 × 1 （Q9V0V6） 30S ribosomal protein S13 × 1 （Q9V1A0） 30S ribosomal protein S14 type Z × 1 （P62012） 30S ribosomal protein S17e × 1 （Q9V0G0） 30S ribosomal protein S19 × 1 （Q9V1T9） 30S ribosomal protein S19e × 1 （Q9V0G8） 30S ribosomal protein S28e × 1 （P61029） 30S ribosomal protein S27ae × 1 （P61238） 30S ribosomal protein S3 × 1 （Q9V1U1） initiator Met-tRNA fMet from E. coli (A1U72 variant) × 1 Translation initiation factor 1A × 1 （Q9V138） MAGNESIUM ION × 8 ZINC ION × 1 water × 3	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL7A_PYRAB
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain 3； PDBConstruct 1–123； UniProt 1–123

Translation initiation factor 1A

Pyrococcus abyssi (strain GE5 / Orsay)

UniProt Q9V138

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 13 RNA 2	16S ribosomal RNA × 1 30S ribosomal protein S7 × 1 （Q9V109） 30S ribosomal protein S9 × 1 （Q9V195） 30S ribosomal protein S10 × 1 （Q9V0V6） 30S ribosomal protein S13 × 1 （Q9V1A0） 30S ribosomal protein S14 type Z × 1 （P62012） 30S ribosomal protein S17e × 1 （Q9V0G0） 30S ribosomal protein S19 × 1 （Q9V1T9） 30S ribosomal protein S19e × 1 （Q9V0G8） 30S ribosomal protein S28e × 1 （P61029） 30S ribosomal protein S27ae × 1 （P61238） 30S ribosomal protein S3 × 1 （Q9V1U1） 50S ribosomal protein L7Ae × 1 （P62008） initiator Met-tRNA fMet from E. coli (A1U72 variant) × 1 MAGNESIUM ION × 8 ZINC ION × 1 water × 3	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	IF1A_PYRAB
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain 6； PDBConstruct 1–113； UniProt 1–113

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6swe
Deposition date deposition_date	2019-09-20
Structure title title	IC2 head of cryo-EM structure of a full archaeal ribosomal translation initiation complex devoid of aIF1 in P. abyssi
Keywords keywords	Translation initiation, cryo-EM, ribosome, tRNA, evolution, archaea, rRNA modifications; RIBOSOME
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6swe__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6swe__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6swe__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	44.53 Å
Rg (electron density)	45.99 Å
Total Rg	46.05 Å
Atom count	22719
Residues	1998
Excluded volume	367940 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6swe__assembly_1__model_1`	pentadecameric （15）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (18)

Entity 1 Entity 1 polymer

Description description	16S ribosomal RNA
Molecular weight formula_weight	152069.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	2
Atom count atom_count	22737

GUAAGGCGGGGGAGCACUACAAGGGGUGGAGCGUGCGGUUUAAUUGGAUUCAACGCCGGGAACCUCACNGGGGGCGACGGCAGGAUGAAGGCCAGGCUGAAGGUCUUGCCGGACGCGCCGAGAGGAGGUGCAUGGCCGCNGUCAGCUCGGCGUCCACUUAAGUGUGGUAACGAGCGAGACCCGCGCCCCCAGUUGCCAGUCCCUCCCGCUCGGGAGGGAGGCACUCUGGGGGGACUGCCGGCGAUAAGCNGGAGGAAGGGGCGGGCGACGGUAGGUCAGUAUGCCCNGAAACCCCNGGGCUACACGCGCGCUACAAUGGGCGGGACAAUGGGUGCNGACCCNGAAAGGGGGAGGUAAUCCCCUAAACCCGCCCUCAGUUCGGAUCGCGGGCUGCAACUCGCCCGCGUGAAGCUGGAAUCCCUAGUACCCGCGCGUCAUCAUCGCGCGGCGAAUACGUCCCUGCUCCUU

Entity 2 Entity 2 polymer

Description description	30S ribosomal protein S7
Molecular weight formula_weight	24662.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

MAKPLSERFFIPHEIKVMGRWSTEDVEVRDPSLKPYINLEPRLLPHTHGRHAKKHFGKANVHIVERLINKIMRSGGSHYKVAGHFMRREHRSLNSKKVKAYEVVKEAFKIIEKRTGKNPIQVLVWAIENAAPREDTTSVMFGGIRYHVAVDISPMRRLDVALRNIALGASAKCYRTKMSFAEALAEEIILAANKDPKSYAYSKKLEIERIAESSR

Entity 3 Entity 3 polymer

Description description	30S ribosomal protein S9
Molecular weight formula_weight	15293.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K

MRIIQTTGKRKTAIARAVIREGKGRVRINGKPVELVEPEIARFTILEPLILAGEEIWNSVDIDVKVQGGGFMGQAEAARIAIARALVEWTGDMNLKEKFIKYDRTMLVGDPRRTEPHKPNRSTKGPRAKRQKSYR

Entity 4 Entity 4 polymer

Description description	30S ribosomal protein S10
Molecular weight formula_weight	11795.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

MQKARIKLASTNVRSLEEVANQIKQIAERTGVRMSGPIPLPTKRIRIVTRKSPDGEGSATFDRWELRIHKRLIDIEADERAMRQIMRIRVPEDVTIEIELIS

Entity 5 Entity 5 polymer

Description description	30S ribosomal protein S13
Molecular weight formula_weight	16992.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	O

MADFRHIVRVAGVDLDGNKQLRWALTAIKGVGINFATMVCRVAGLDPFMKAGYLTDEQVKKIEEILQDPVAHGIPRWAVNRPKDYETGRDLHLITAKLDMAIREDIMRLRRIRAYRGIRHELGLPVRGQRTRSNFRRGQTVGVSRKKK

Entity 6 Entity 6 polymer

Description description	30S ribosomal protein S14 type Z
Molecular weight formula_weight	6644.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	P

MAKADYNKRKPRKFGKGARRCIRCGQYGPIIRIHGLMLCRHCFREVAPKLGFRKYE

Entity 7 Entity 7 polymer

Description description	30S ribosomal protein S17e
Molecular weight formula_weight	8059.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	S

MGKIRQGFIKRVARELFNKYPNEFTRDFEHNKKKVEELTNVTSKKIRNRIAGYITKLVRMKEEGKIL

Entity 8 Entity 8 polymer

Description description	30S ribosomal protein S19
Molecular weight formula_weight	15307.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	T

MARKEFRYRGYTLEQLMNMSLEELAKLLPARQRRSLKRGLTPEQKKLLRKIRLAKKGKYNKPIRTHCRDMIVLPEMVGLTIYVHNGKEFVPVEIKPEMIGHYLGEFAPTRKRVQHGAPGIGATRSSMFVAVK

Entity 9 Entity 9 polymer

Description description	30S ribosomal protein S19e
Molecular weight formula_weight	17422.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	U

MATVYDVPGDLLVERVAQRLKEIPEIKPPEWAPFVKTGRHKERLPEQEDWWYYRVASILRRVYLDGPVGIERLRTYYGGRKNRGHAPERFYKAGGSIIRKALQQLEAAGFVEKVPGKGRVITPKGRSFLDKIATELKKELEEIIPELKKY

Entity 10 Entity 10 polymer

Description description	30S ribosomal protein S28e
Molecular weight formula_weight	8102.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	X

MAEDEGYPAEVIEIIGRTGTTGDVTQVKVRILEGRDKGRVIRRNVRGPVRVGDILILRETEREAREIKSRR

Entity 11 Entity 11 polymer

Description description	30S ribosomal protein S27ae
Molecular weight formula_weight	5992.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Y

MGQKWKLYIVKDGKVIRKNKFCPRCGPGVFMADHGDRWACGRCGYTEWKKK

Entity 12 Entity 12 polymer

Description description	30S ribosomal protein S3
Molecular weight formula_weight	23472.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Z

MAIERYFIREAVKEMLIDEFLEKELRRAGYGGLDIKKTPLGTKVIIFAANPGYVIGRGGRRIRELTRILERQFGLENPQIDVQEIKNPYLNAKVQAVRIAQALERGIHFRRAAYAAMRAIMSNGARGVEIRISGKLTGERAKSVRFYQGYLAKVGNPAETLVSKGYAQALLKLGVIGVKVAIMPPDARLPDEIEIIEKPVEEEVSSNEAE

Entity 13 Entity 13 polymer

Description description	50S ribosomal protein L7Ae
Molecular weight formula_weight	13442.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	3

MAKPSYVKFEVPKELAEKALQAVEIARDTGKIRKGTNETTKAVERGQAKLVIIAEDVDPEEIVAHLPPLCEEKEIPYIYVPSKKELGAAAGIEVAAASVAIIEPGKARDLVEEIAMKVRELMK

Entity 14 Entity 14 polymer

Description description	initiator Met-tRNA fMet from E. coli (A1U72 variant)
Molecular weight formula_weight	5761.5 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	4

GUCGGGCUCAUAACCCGA

Source Source

Source organism organism	Escherichia coli
NCBI taxonomy ID ncbi_taxonomy_id	562
Host organism host_organism	Escherichia coli

Entity 15 Entity 15 polymer

Description description	Translation initiation factor 1A
Molecular weight formula_weight	13078.3 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	6

MPKKERKVEGDEVIRVPLPEGNQLFGVVEQALGAGWMDVRCEDGKIRRCRIPGKLRRRVWIRVGDLVIVQPWPVQSDKRGDIVYRYTQTQVDWLLRKGKITQEFLTGGSLLVE

Source Source

Source organism organism	Pyrococcus abyssi (strain GE5 / Orsay)
NCBI taxonomy ID ncbi_taxonomy_id	272844
Host organism host_organism	Escherichia coli

Entity 16 Entity 16 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	8

Entity 17 Entity 17 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 18 Entity 18 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	18

▼

6. Fold Classification (SCOP + CATH) 8 domains

CATH v4.4 (8 domains)

Domain ID domain_id	6swe300
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1330 — 60s Ribosomal Protein L30; Chain: A;
Homologous superfamily homologous superfamily	30 — Ribosomal protein L30/S12

Domain ID domain_id	6swe600
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	50 — OB fold (Dihydrolipoamide Acetyltransferase, E2P)
Homologous superfamily homologous superfamily	140 — Nucleic acid-binding proteins

Domain ID domain_id	6sweH00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	455 — Ribosomal Protein S7
Homologous superfamily homologous superfamily	10 — Ribosomal protein S7/S5

Domain ID domain_id	6sweK00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	230 — Ribosomal Protein S5; domain 2
Homologous superfamily homologous superfamily	10 —

Domain ID domain_id	6sweL00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	600 — Ribosomal protein S10

Domain ID domain_id	6sweP00
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	830 — 30s Ribosomal Protein S14; Chain N
Homologous superfamily homologous superfamily	10 — Ribosomal Protein S14/S29

Domain ID domain_id	6sweS00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	60 — Diphtheria Toxin Repressor; domain 2
Homologous superfamily homologous superfamily	20 — Ribosomal protein S17

Domain ID domain_id	6sweX00
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	50 — OB fold (Dihydrolipoamide Acetyltransferase, E2P)
Homologous superfamily homologous superfamily	140 — Nucleic acid-binding proteins

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	1

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.10 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	142000

IC2 head of cryo-EM structure of a full archaeal ribosomal translation initiation complex devoid of aIF1 in P. abyssi

1. Protein Identity and Related Structures Protein Identity & Related Structures

30S ribosomal protein S7

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

30S ribosomal protein S9

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

30S ribosomal protein S10

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

30S ribosomal protein S13

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

30S ribosomal protein S14 type Z

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

30S ribosomal protein S17e

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

30S ribosomal protein S19

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

30S ribosomal protein S19e

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

30S ribosomal protein S28e

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

30S ribosomal protein S27ae

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer