6swc

IC2B model of cryo-EM structure of a full archaeal ribosomal translation initiation complex devoid of aIF1 in P. abyssi

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

30S ribosomal protein S3Ae

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 32 RNA 3	16S ribosomal rRNA × 1 30S ribosomal protein S2 × 1 （Q9V191） Zn-ribbon RNA-binding protein involved in translation × 1 （G8ZFK7） 30S ribosomal protein S4 × 1 （P61992） 30S ribosomal protein S4e × 1 （Q9V1U8） 30S ribosomal protein S5 × 1 （Q9V1V5） 30S ribosomal protein S6e × 1 （Q9UYS3） 30S ribosomal protein S7 × 1 （Q9V109） 30S ribosomal protein S8 × 1 （Q9V1V0） 30S ribosomal protein S8e × 1 （Q9UZL4） 30S ribosomal protein S9 × 1 （Q9V195） 30S ribosomal protein S10 × 1 （Q9V0V6） 30S ribosomal protein S11 × 1 （P62010） 30S ribosomal protein S12 × 1 （P61994） 30S ribosomal protein S13 × 1 （Q9V1A0） 30S ribosomal protein S14 type Z × 1 （P62012） 30S ribosomal protein S15 × 1 （Q9V2K9） 30S ribosomal protein S17 × 1 （Q9V1U5） 30S ribosomal protein S17e × 1 （Q9V0G0） 30S ribosomal protein S19 × 1 （Q9V1T9） 30S ribosomal protein S19e × 1 （Q9V0G8） 30S ribosomal protein S24e × 1 （Q9UY20） 30S ribosomal protein S27e × 1 （Q9UXZ3） 30S ribosomal protein S28e × 1 （P61029） 30S ribosomal protein S27ae × 1 （P61238） 30S ribosomal protein S3 × 1 （Q9V1U1） 30S ribosomal protein aL41 × 1 50S ribosomal protein L7Ae × 1 （P62008） mRNA × 1 initiator Met-tRNA fMet from E. coli (A1U72 variant) × 1 Translation initiation factor 1A × 1 （Q9V138） Translation initiation factor 2 subunit gamma × 1 Translation initiation factor 2 subunit beta × 1 Translation initiation factor 2 subunit alpha × 1 （Q97Z79） MAGNESIUM ION × 34 ZINC ION × 6 METHIONINE × 1 PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1 water × 4	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS3A_PYRAB
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain A； PDBConstruct 1–199； UniProt 1–199

30S ribosomal protein S2

OrganismNot specified

UniProt Q9V191

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 32 RNA 3	16S ribosomal rRNA × 1 30S ribosomal protein S3Ae × 1 （Q9V2K7） Zn-ribbon RNA-binding protein involved in translation × 1 （G8ZFK7） 30S ribosomal protein S4 × 1 （P61992） 30S ribosomal protein S4e × 1 （Q9V1U8） 30S ribosomal protein S5 × 1 （Q9V1V5） 30S ribosomal protein S6e × 1 （Q9UYS3） 30S ribosomal protein S7 × 1 （Q9V109） 30S ribosomal protein S8 × 1 （Q9V1V0） 30S ribosomal protein S8e × 1 （Q9UZL4） 30S ribosomal protein S9 × 1 （Q9V195） 30S ribosomal protein S10 × 1 （Q9V0V6） 30S ribosomal protein S11 × 1 （P62010） 30S ribosomal protein S12 × 1 （P61994） 30S ribosomal protein S13 × 1 （Q9V1A0） 30S ribosomal protein S14 type Z × 1 （P62012） 30S ribosomal protein S15 × 1 （Q9V2K9） 30S ribosomal protein S17 × 1 （Q9V1U5） 30S ribosomal protein S17e × 1 （Q9V0G0） 30S ribosomal protein S19 × 1 （Q9V1T9） 30S ribosomal protein S19e × 1 （Q9V0G8） 30S ribosomal protein S24e × 1 （Q9UY20） 30S ribosomal protein S27e × 1 （Q9UXZ3） 30S ribosomal protein S28e × 1 （P61029） 30S ribosomal protein S27ae × 1 （P61238） 30S ribosomal protein S3 × 1 （Q9V1U1） 30S ribosomal protein aL41 × 1 50S ribosomal protein L7Ae × 1 （P62008） mRNA × 1 initiator Met-tRNA fMet from E. coli (A1U72 variant) × 1 Translation initiation factor 1A × 1 （Q9V138） Translation initiation factor 2 subunit gamma × 1 Translation initiation factor 2 subunit beta × 1 Translation initiation factor 2 subunit alpha × 1 （Q97Z79） MAGNESIUM ION × 34 ZINC ION × 6 METHIONINE × 1 PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1 water × 4	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS2_PYRAB
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain B； PDBConstruct 1–202； UniProt 1–202

Zn-ribbon RNA-binding protein involved in translation

OrganismNot specified

UniProt G8ZFK7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 32 RNA 3	16S ribosomal rRNA × 1 30S ribosomal protein S3Ae × 1 （Q9V2K7） 30S ribosomal protein S2 × 1 （Q9V191） 30S ribosomal protein S4 × 1 （P61992） 30S ribosomal protein S4e × 1 （Q9V1U8） 30S ribosomal protein S5 × 1 （Q9V1V5） 30S ribosomal protein S6e × 1 （Q9UYS3） 30S ribosomal protein S7 × 1 （Q9V109） 30S ribosomal protein S8 × 1 （Q9V1V0） 30S ribosomal protein S8e × 1 （Q9UZL4） 30S ribosomal protein S9 × 1 （Q9V195） 30S ribosomal protein S10 × 1 （Q9V0V6） 30S ribosomal protein S11 × 1 （P62010） 30S ribosomal protein S12 × 1 （P61994） 30S ribosomal protein S13 × 1 （Q9V1A0） 30S ribosomal protein S14 type Z × 1 （P62012） 30S ribosomal protein S15 × 1 （Q9V2K9） 30S ribosomal protein S17 × 1 （Q9V1U5） 30S ribosomal protein S17e × 1 （Q9V0G0） 30S ribosomal protein S19 × 1 （Q9V1T9） 30S ribosomal protein S19e × 1 （Q9V0G8） 30S ribosomal protein S24e × 1 （Q9UY20） 30S ribosomal protein S27e × 1 （Q9UXZ3） 30S ribosomal protein S28e × 1 （P61029） 30S ribosomal protein S27ae × 1 （P61238） 30S ribosomal protein S3 × 1 （Q9V1U1） 30S ribosomal protein aL41 × 1 50S ribosomal protein L7Ae × 1 （P62008） mRNA × 1 initiator Met-tRNA fMet from E. coli (A1U72 variant) × 1 Translation initiation factor 1A × 1 （Q9V138） Translation initiation factor 2 subunit gamma × 1 Translation initiation factor 2 subunit beta × 1 Translation initiation factor 2 subunit alpha × 1 （Q97Z79） MAGNESIUM ION × 34 ZINC ION × 6 METHIONINE × 1 PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1 water × 4	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	G8ZFK7_PYRAB
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain C； PDBConstruct 1–63； UniProt 1–63

30S ribosomal protein S4

OrganismNot specified

UniProt P61992

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 32 RNA 3	16S ribosomal rRNA × 1 30S ribosomal protein S3Ae × 1 （Q9V2K7） 30S ribosomal protein S2 × 1 （Q9V191） Zn-ribbon RNA-binding protein involved in translation × 1 （G8ZFK7） 30S ribosomal protein S4e × 1 （Q9V1U8） 30S ribosomal protein S5 × 1 （Q9V1V5） 30S ribosomal protein S6e × 1 （Q9UYS3） 30S ribosomal protein S7 × 1 （Q9V109） 30S ribosomal protein S8 × 1 （Q9V1V0） 30S ribosomal protein S8e × 1 （Q9UZL4） 30S ribosomal protein S9 × 1 （Q9V195） 30S ribosomal protein S10 × 1 （Q9V0V6） 30S ribosomal protein S11 × 1 （P62010） 30S ribosomal protein S12 × 1 （P61994） 30S ribosomal protein S13 × 1 （Q9V1A0） 30S ribosomal protein S14 type Z × 1 （P62012） 30S ribosomal protein S15 × 1 （Q9V2K9） 30S ribosomal protein S17 × 1 （Q9V1U5） 30S ribosomal protein S17e × 1 （Q9V0G0） 30S ribosomal protein S19 × 1 （Q9V1T9） 30S ribosomal protein S19e × 1 （Q9V0G8） 30S ribosomal protein S24e × 1 （Q9UY20） 30S ribosomal protein S27e × 1 （Q9UXZ3） 30S ribosomal protein S28e × 1 （P61029） 30S ribosomal protein S27ae × 1 （P61238） 30S ribosomal protein S3 × 1 （Q9V1U1） 30S ribosomal protein aL41 × 1 50S ribosomal protein L7Ae × 1 （P62008） mRNA × 1 initiator Met-tRNA fMet from E. coli (A1U72 variant) × 1 Translation initiation factor 1A × 1 （Q9V138） Translation initiation factor 2 subunit gamma × 1 Translation initiation factor 2 subunit beta × 1 Translation initiation factor 2 subunit alpha × 1 （Q97Z79） MAGNESIUM ION × 34 ZINC ION × 6 METHIONINE × 1 PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1 water × 4	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS4_PYRAB
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain D； PDBConstruct 1–180； UniProt 1–180

30S ribosomal protein S4e

OrganismNot specified

UniProt Q9V1U8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 32 RNA 3	16S ribosomal rRNA × 1 30S ribosomal protein S3Ae × 1 （Q9V2K7） 30S ribosomal protein S2 × 1 （Q9V191） Zn-ribbon RNA-binding protein involved in translation × 1 （G8ZFK7） 30S ribosomal protein S4 × 1 （P61992） 30S ribosomal protein S5 × 1 （Q9V1V5） 30S ribosomal protein S6e × 1 （Q9UYS3） 30S ribosomal protein S7 × 1 （Q9V109） 30S ribosomal protein S8 × 1 （Q9V1V0） 30S ribosomal protein S8e × 1 （Q9UZL4） 30S ribosomal protein S9 × 1 （Q9V195） 30S ribosomal protein S10 × 1 （Q9V0V6） 30S ribosomal protein S11 × 1 （P62010） 30S ribosomal protein S12 × 1 （P61994） 30S ribosomal protein S13 × 1 （Q9V1A0） 30S ribosomal protein S14 type Z × 1 （P62012） 30S ribosomal protein S15 × 1 （Q9V2K9） 30S ribosomal protein S17 × 1 （Q9V1U5） 30S ribosomal protein S17e × 1 （Q9V0G0） 30S ribosomal protein S19 × 1 （Q9V1T9） 30S ribosomal protein S19e × 1 （Q9V0G8） 30S ribosomal protein S24e × 1 （Q9UY20） 30S ribosomal protein S27e × 1 （Q9UXZ3） 30S ribosomal protein S28e × 1 （P61029） 30S ribosomal protein S27ae × 1 （P61238） 30S ribosomal protein S3 × 1 （Q9V1U1） 30S ribosomal protein aL41 × 1 50S ribosomal protein L7Ae × 1 （P62008） mRNA × 1 initiator Met-tRNA fMet from E. coli (A1U72 variant) × 1 Translation initiation factor 1A × 1 （Q9V138） Translation initiation factor 2 subunit gamma × 1 Translation initiation factor 2 subunit beta × 1 Translation initiation factor 2 subunit alpha × 1 （Q97Z79） MAGNESIUM ION × 34 ZINC ION × 6 METHIONINE × 1 PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1 water × 4	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS4E_PYRAB
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain E； PDBConstruct 1–243； UniProt 1–243

30S ribosomal protein S5

OrganismNot specified

UniProt Q9V1V5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 32 RNA 3	16S ribosomal rRNA × 1 30S ribosomal protein S3Ae × 1 （Q9V2K7） 30S ribosomal protein S2 × 1 （Q9V191） Zn-ribbon RNA-binding protein involved in translation × 1 （G8ZFK7） 30S ribosomal protein S4 × 1 （P61992） 30S ribosomal protein S4e × 1 （Q9V1U8） 30S ribosomal protein S6e × 1 （Q9UYS3） 30S ribosomal protein S7 × 1 （Q9V109） 30S ribosomal protein S8 × 1 （Q9V1V0） 30S ribosomal protein S8e × 1 （Q9UZL4） 30S ribosomal protein S9 × 1 （Q9V195） 30S ribosomal protein S10 × 1 （Q9V0V6） 30S ribosomal protein S11 × 1 （P62010） 30S ribosomal protein S12 × 1 （P61994） 30S ribosomal protein S13 × 1 （Q9V1A0） 30S ribosomal protein S14 type Z × 1 （P62012） 30S ribosomal protein S15 × 1 （Q9V2K9） 30S ribosomal protein S17 × 1 （Q9V1U5） 30S ribosomal protein S17e × 1 （Q9V0G0） 30S ribosomal protein S19 × 1 （Q9V1T9） 30S ribosomal protein S19e × 1 （Q9V0G8） 30S ribosomal protein S24e × 1 （Q9UY20） 30S ribosomal protein S27e × 1 （Q9UXZ3） 30S ribosomal protein S28e × 1 （P61029） 30S ribosomal protein S27ae × 1 （P61238） 30S ribosomal protein S3 × 1 （Q9V1U1） 30S ribosomal protein aL41 × 1 50S ribosomal protein L7Ae × 1 （P62008） mRNA × 1 initiator Met-tRNA fMet from E. coli (A1U72 variant) × 1 Translation initiation factor 1A × 1 （Q9V138） Translation initiation factor 2 subunit gamma × 1 Translation initiation factor 2 subunit beta × 1 Translation initiation factor 2 subunit alpha × 1 （Q97Z79） MAGNESIUM ION × 34 ZINC ION × 6 METHIONINE × 1 PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1 water × 4	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS5_PYRAB
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain F； PDBConstruct 1–236； UniProt 1–236

30S ribosomal protein S6e

OrganismNot specified

UniProt Q9UYS3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 32 RNA 3	16S ribosomal rRNA × 1 30S ribosomal protein S3Ae × 1 （Q9V2K7） 30S ribosomal protein S2 × 1 （Q9V191） Zn-ribbon RNA-binding protein involved in translation × 1 （G8ZFK7） 30S ribosomal protein S4 × 1 （P61992） 30S ribosomal protein S4e × 1 （Q9V1U8） 30S ribosomal protein S5 × 1 （Q9V1V5） 30S ribosomal protein S7 × 1 （Q9V109） 30S ribosomal protein S8 × 1 （Q9V1V0） 30S ribosomal protein S8e × 1 （Q9UZL4） 30S ribosomal protein S9 × 1 （Q9V195） 30S ribosomal protein S10 × 1 （Q9V0V6） 30S ribosomal protein S11 × 1 （P62010） 30S ribosomal protein S12 × 1 （P61994） 30S ribosomal protein S13 × 1 （Q9V1A0） 30S ribosomal protein S14 type Z × 1 （P62012） 30S ribosomal protein S15 × 1 （Q9V2K9） 30S ribosomal protein S17 × 1 （Q9V1U5） 30S ribosomal protein S17e × 1 （Q9V0G0） 30S ribosomal protein S19 × 1 （Q9V1T9） 30S ribosomal protein S19e × 1 （Q9V0G8） 30S ribosomal protein S24e × 1 （Q9UY20） 30S ribosomal protein S27e × 1 （Q9UXZ3） 30S ribosomal protein S28e × 1 （P61029） 30S ribosomal protein S27ae × 1 （P61238） 30S ribosomal protein S3 × 1 （Q9V1U1） 30S ribosomal protein aL41 × 1 50S ribosomal protein L7Ae × 1 （P62008） mRNA × 1 initiator Met-tRNA fMet from E. coli (A1U72 variant) × 1 Translation initiation factor 1A × 1 （Q9V138） Translation initiation factor 2 subunit gamma × 1 Translation initiation factor 2 subunit beta × 1 Translation initiation factor 2 subunit alpha × 1 （Q97Z79） MAGNESIUM ION × 34 ZINC ION × 6 METHIONINE × 1 PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1 water × 4	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS6E_PYRAB
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain G； PDBConstruct 1–125； UniProt 1–125

30S ribosomal protein S7

OrganismNot specified

UniProt Q9V109

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 32 RNA 3	16S ribosomal rRNA × 1 30S ribosomal protein S3Ae × 1 （Q9V2K7） 30S ribosomal protein S2 × 1 （Q9V191） Zn-ribbon RNA-binding protein involved in translation × 1 （G8ZFK7） 30S ribosomal protein S4 × 1 （P61992） 30S ribosomal protein S4e × 1 （Q9V1U8） 30S ribosomal protein S5 × 1 （Q9V1V5） 30S ribosomal protein S6e × 1 （Q9UYS3） 30S ribosomal protein S8 × 1 （Q9V1V0） 30S ribosomal protein S8e × 1 （Q9UZL4） 30S ribosomal protein S9 × 1 （Q9V195） 30S ribosomal protein S10 × 1 （Q9V0V6） 30S ribosomal protein S11 × 1 （P62010） 30S ribosomal protein S12 × 1 （P61994） 30S ribosomal protein S13 × 1 （Q9V1A0） 30S ribosomal protein S14 type Z × 1 （P62012） 30S ribosomal protein S15 × 1 （Q9V2K9） 30S ribosomal protein S17 × 1 （Q9V1U5） 30S ribosomal protein S17e × 1 （Q9V0G0） 30S ribosomal protein S19 × 1 （Q9V1T9） 30S ribosomal protein S19e × 1 （Q9V0G8） 30S ribosomal protein S24e × 1 （Q9UY20） 30S ribosomal protein S27e × 1 （Q9UXZ3） 30S ribosomal protein S28e × 1 （P61029） 30S ribosomal protein S27ae × 1 （P61238） 30S ribosomal protein S3 × 1 （Q9V1U1） 30S ribosomal protein aL41 × 1 50S ribosomal protein L7Ae × 1 （P62008） mRNA × 1 initiator Met-tRNA fMet from E. coli (A1U72 variant) × 1 Translation initiation factor 1A × 1 （Q9V138） Translation initiation factor 2 subunit gamma × 1 Translation initiation factor 2 subunit beta × 1 Translation initiation factor 2 subunit alpha × 1 （Q97Z79） MAGNESIUM ION × 34 ZINC ION × 6 METHIONINE × 1 PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1 water × 4	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS7_PYRAB
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain H； PDBConstruct 1–215； UniProt 1–215

30S ribosomal protein S8

OrganismNot specified

UniProt Q9V1V0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 32 RNA 3	16S ribosomal rRNA × 1 30S ribosomal protein S3Ae × 1 （Q9V2K7） 30S ribosomal protein S2 × 1 （Q9V191） Zn-ribbon RNA-binding protein involved in translation × 1 （G8ZFK7） 30S ribosomal protein S4 × 1 （P61992） 30S ribosomal protein S4e × 1 （Q9V1U8） 30S ribosomal protein S5 × 1 （Q9V1V5） 30S ribosomal protein S6e × 1 （Q9UYS3） 30S ribosomal protein S7 × 1 （Q9V109） 30S ribosomal protein S8e × 1 （Q9UZL4） 30S ribosomal protein S9 × 1 （Q9V195） 30S ribosomal protein S10 × 1 （Q9V0V6） 30S ribosomal protein S11 × 1 （P62010） 30S ribosomal protein S12 × 1 （P61994） 30S ribosomal protein S13 × 1 （Q9V1A0） 30S ribosomal protein S14 type Z × 1 （P62012） 30S ribosomal protein S15 × 1 （Q9V2K9） 30S ribosomal protein S17 × 1 （Q9V1U5） 30S ribosomal protein S17e × 1 （Q9V0G0） 30S ribosomal protein S19 × 1 （Q9V1T9） 30S ribosomal protein S19e × 1 （Q9V0G8） 30S ribosomal protein S24e × 1 （Q9UY20） 30S ribosomal protein S27e × 1 （Q9UXZ3） 30S ribosomal protein S28e × 1 （P61029） 30S ribosomal protein S27ae × 1 （P61238） 30S ribosomal protein S3 × 1 （Q9V1U1） 30S ribosomal protein aL41 × 1 50S ribosomal protein L7Ae × 1 （P62008） mRNA × 1 initiator Met-tRNA fMet from E. coli (A1U72 variant) × 1 Translation initiation factor 1A × 1 （Q9V138） Translation initiation factor 2 subunit gamma × 1 Translation initiation factor 2 subunit beta × 1 Translation initiation factor 2 subunit alpha × 1 （Q97Z79） MAGNESIUM ION × 34 ZINC ION × 6 METHIONINE × 1 PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1 water × 4	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS8_PYRAB
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain I； PDBConstruct 1–130； UniProt 1–130

30S ribosomal protein S8e

OrganismNot specified

UniProt Q9UZL4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 32 RNA 3	16S ribosomal rRNA × 1 30S ribosomal protein S3Ae × 1 （Q9V2K7） 30S ribosomal protein S2 × 1 （Q9V191） Zn-ribbon RNA-binding protein involved in translation × 1 （G8ZFK7） 30S ribosomal protein S4 × 1 （P61992） 30S ribosomal protein S4e × 1 （Q9V1U8） 30S ribosomal protein S5 × 1 （Q9V1V5） 30S ribosomal protein S6e × 1 （Q9UYS3） 30S ribosomal protein S7 × 1 （Q9V109） 30S ribosomal protein S8 × 1 （Q9V1V0） 30S ribosomal protein S9 × 1 （Q9V195） 30S ribosomal protein S10 × 1 （Q9V0V6） 30S ribosomal protein S11 × 1 （P62010） 30S ribosomal protein S12 × 1 （P61994） 30S ribosomal protein S13 × 1 （Q9V1A0） 30S ribosomal protein S14 type Z × 1 （P62012） 30S ribosomal protein S15 × 1 （Q9V2K9） 30S ribosomal protein S17 × 1 （Q9V1U5） 30S ribosomal protein S17e × 1 （Q9V0G0） 30S ribosomal protein S19 × 1 （Q9V1T9） 30S ribosomal protein S19e × 1 （Q9V0G8） 30S ribosomal protein S24e × 1 （Q9UY20） 30S ribosomal protein S27e × 1 （Q9UXZ3） 30S ribosomal protein S28e × 1 （P61029） 30S ribosomal protein S27ae × 1 （P61238） 30S ribosomal protein S3 × 1 （Q9V1U1） 30S ribosomal protein aL41 × 1 50S ribosomal protein L7Ae × 1 （P62008） mRNA × 1 initiator Met-tRNA fMet from E. coli (A1U72 variant) × 1 Translation initiation factor 1A × 1 （Q9V138） Translation initiation factor 2 subunit gamma × 1 Translation initiation factor 2 subunit beta × 1 Translation initiation factor 2 subunit alpha × 1 （Q97Z79） MAGNESIUM ION × 34 ZINC ION × 6 METHIONINE × 1 PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1 water × 4	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS8E_PYRAB
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain J； PDBConstruct 1–127； UniProt 1–127

30S ribosomal protein S9

OrganismNot specified

UniProt Q9V195

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 32 RNA 3	16S ribosomal rRNA × 1 30S ribosomal protein S3Ae × 1 （Q9V2K7） 30S ribosomal protein S2 × 1 （Q9V191） Zn-ribbon RNA-binding protein involved in translation × 1 （G8ZFK7） 30S ribosomal protein S4 × 1 （P61992） 30S ribosomal protein S4e × 1 （Q9V1U8） 30S ribosomal protein S5 × 1 （Q9V1V5） 30S ribosomal protein S6e × 1 （Q9UYS3） 30S ribosomal protein S7 × 1 （Q9V109） 30S ribosomal protein S8 × 1 （Q9V1V0） 30S ribosomal protein S8e × 1 （Q9UZL4） 30S ribosomal protein S10 × 1 （Q9V0V6） 30S ribosomal protein S11 × 1 （P62010） 30S ribosomal protein S12 × 1 （P61994） 30S ribosomal protein S13 × 1 （Q9V1A0） 30S ribosomal protein S14 type Z × 1 （P62012） 30S ribosomal protein S15 × 1 （Q9V2K9） 30S ribosomal protein S17 × 1 （Q9V1U5） 30S ribosomal protein S17e × 1 （Q9V0G0） 30S ribosomal protein S19 × 1 （Q9V1T9） 30S ribosomal protein S19e × 1 （Q9V0G8） 30S ribosomal protein S24e × 1 （Q9UY20） 30S ribosomal protein S27e × 1 （Q9UXZ3） 30S ribosomal protein S28e × 1 （P61029） 30S ribosomal protein S27ae × 1 （P61238） 30S ribosomal protein S3 × 1 （Q9V1U1） 30S ribosomal protein aL41 × 1 50S ribosomal protein L7Ae × 1 （P62008） mRNA × 1 initiator Met-tRNA fMet from E. coli (A1U72 variant) × 1 Translation initiation factor 1A × 1 （Q9V138） Translation initiation factor 2 subunit gamma × 1 Translation initiation factor 2 subunit beta × 1 Translation initiation factor 2 subunit alpha × 1 （Q97Z79） MAGNESIUM ION × 34 ZINC ION × 6 METHIONINE × 1 PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1 water × 4	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS9_PYRAB
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain K； PDBConstruct 1–135； UniProt 1–135

30S ribosomal protein S10

OrganismNot specified

UniProt Q9V0V6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 32 RNA 3	16S ribosomal rRNA × 1 30S ribosomal protein S3Ae × 1 （Q9V2K7） 30S ribosomal protein S2 × 1 （Q9V191） Zn-ribbon RNA-binding protein involved in translation × 1 （G8ZFK7） 30S ribosomal protein S4 × 1 （P61992） 30S ribosomal protein S4e × 1 （Q9V1U8） 30S ribosomal protein S5 × 1 （Q9V1V5） 30S ribosomal protein S6e × 1 （Q9UYS3） 30S ribosomal protein S7 × 1 （Q9V109） 30S ribosomal protein S8 × 1 （Q9V1V0） 30S ribosomal protein S8e × 1 （Q9UZL4） 30S ribosomal protein S9 × 1 （Q9V195） 30S ribosomal protein S11 × 1 （P62010） 30S ribosomal protein S12 × 1 （P61994） 30S ribosomal protein S13 × 1 （Q9V1A0） 30S ribosomal protein S14 type Z × 1 （P62012） 30S ribosomal protein S15 × 1 （Q9V2K9） 30S ribosomal protein S17 × 1 （Q9V1U5） 30S ribosomal protein S17e × 1 （Q9V0G0） 30S ribosomal protein S19 × 1 （Q9V1T9） 30S ribosomal protein S19e × 1 （Q9V0G8） 30S ribosomal protein S24e × 1 （Q9UY20） 30S ribosomal protein S27e × 1 （Q9UXZ3） 30S ribosomal protein S28e × 1 （P61029） 30S ribosomal protein S27ae × 1 （P61238） 30S ribosomal protein S3 × 1 （Q9V1U1） 30S ribosomal protein aL41 × 1 50S ribosomal protein L7Ae × 1 （P62008） mRNA × 1 initiator Met-tRNA fMet from E. coli (A1U72 variant) × 1 Translation initiation factor 1A × 1 （Q9V138） Translation initiation factor 2 subunit gamma × 1 Translation initiation factor 2 subunit beta × 1 Translation initiation factor 2 subunit alpha × 1 （Q97Z79） MAGNESIUM ION × 34 ZINC ION × 6 METHIONINE × 1 PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1 water × 4	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS10_PYRAB
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain L； PDBConstruct 1–102； UniProt 1–102

30S ribosomal protein S11

OrganismNot specified

UniProt P62010

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 32 RNA 3	16S ribosomal rRNA × 1 30S ribosomal protein S3Ae × 1 （Q9V2K7） 30S ribosomal protein S2 × 1 （Q9V191） Zn-ribbon RNA-binding protein involved in translation × 1 （G8ZFK7） 30S ribosomal protein S4 × 1 （P61992） 30S ribosomal protein S4e × 1 （Q9V1U8） 30S ribosomal protein S5 × 1 （Q9V1V5） 30S ribosomal protein S6e × 1 （Q9UYS3） 30S ribosomal protein S7 × 1 （Q9V109） 30S ribosomal protein S8 × 1 （Q9V1V0） 30S ribosomal protein S8e × 1 （Q9UZL4） 30S ribosomal protein S9 × 1 （Q9V195） 30S ribosomal protein S10 × 1 （Q9V0V6） 30S ribosomal protein S12 × 1 （P61994） 30S ribosomal protein S13 × 1 （Q9V1A0） 30S ribosomal protein S14 type Z × 1 （P62012） 30S ribosomal protein S15 × 1 （Q9V2K9） 30S ribosomal protein S17 × 1 （Q9V1U5） 30S ribosomal protein S17e × 1 （Q9V0G0） 30S ribosomal protein S19 × 1 （Q9V1T9） 30S ribosomal protein S19e × 1 （Q9V0G8） 30S ribosomal protein S24e × 1 （Q9UY20） 30S ribosomal protein S27e × 1 （Q9UXZ3） 30S ribosomal protein S28e × 1 （P61029） 30S ribosomal protein S27ae × 1 （P61238） 30S ribosomal protein S3 × 1 （Q9V1U1） 30S ribosomal protein aL41 × 1 50S ribosomal protein L7Ae × 1 （P62008） mRNA × 1 initiator Met-tRNA fMet from E. coli (A1U72 variant) × 1 Translation initiation factor 1A × 1 （Q9V138） Translation initiation factor 2 subunit gamma × 1 Translation initiation factor 2 subunit beta × 1 Translation initiation factor 2 subunit alpha × 1 （Q97Z79） MAGNESIUM ION × 34 ZINC ION × 6 METHIONINE × 1 PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1 water × 4	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS11_PYRAB
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain M； PDBConstruct 1–137； UniProt 1–137

30S ribosomal protein S12

OrganismNot specified

UniProt P61994

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 32 RNA 3	16S ribosomal rRNA × 1 30S ribosomal protein S3Ae × 1 （Q9V2K7） 30S ribosomal protein S2 × 1 （Q9V191） Zn-ribbon RNA-binding protein involved in translation × 1 （G8ZFK7） 30S ribosomal protein S4 × 1 （P61992） 30S ribosomal protein S4e × 1 （Q9V1U8） 30S ribosomal protein S5 × 1 （Q9V1V5） 30S ribosomal protein S6e × 1 （Q9UYS3） 30S ribosomal protein S7 × 1 （Q9V109） 30S ribosomal protein S8 × 1 （Q9V1V0） 30S ribosomal protein S8e × 1 （Q9UZL4） 30S ribosomal protein S9 × 1 （Q9V195） 30S ribosomal protein S10 × 1 （Q9V0V6） 30S ribosomal protein S11 × 1 （P62010） 30S ribosomal protein S13 × 1 （Q9V1A0） 30S ribosomal protein S14 type Z × 1 （P62012） 30S ribosomal protein S15 × 1 （Q9V2K9） 30S ribosomal protein S17 × 1 （Q9V1U5） 30S ribosomal protein S17e × 1 （Q9V0G0） 30S ribosomal protein S19 × 1 （Q9V1T9） 30S ribosomal protein S19e × 1 （Q9V0G8） 30S ribosomal protein S24e × 1 （Q9UY20） 30S ribosomal protein S27e × 1 （Q9UXZ3） 30S ribosomal protein S28e × 1 （P61029） 30S ribosomal protein S27ae × 1 （P61238） 30S ribosomal protein S3 × 1 （Q9V1U1） 30S ribosomal protein aL41 × 1 50S ribosomal protein L7Ae × 1 （P62008） mRNA × 1 initiator Met-tRNA fMet from E. coli (A1U72 variant) × 1 Translation initiation factor 1A × 1 （Q9V138） Translation initiation factor 2 subunit gamma × 1 Translation initiation factor 2 subunit beta × 1 Translation initiation factor 2 subunit alpha × 1 （Q97Z79） MAGNESIUM ION × 34 ZINC ION × 6 METHIONINE × 1 PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1 water × 4	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS12_PYRAB
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain N； PDBConstruct 1–147； UniProt 1–147

30S ribosomal protein S13

OrganismNot specified

UniProt Q9V1A0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 32 RNA 3	16S ribosomal rRNA × 1 30S ribosomal protein S3Ae × 1 （Q9V2K7） 30S ribosomal protein S2 × 1 （Q9V191） Zn-ribbon RNA-binding protein involved in translation × 1 （G8ZFK7） 30S ribosomal protein S4 × 1 （P61992） 30S ribosomal protein S4e × 1 （Q9V1U8） 30S ribosomal protein S5 × 1 （Q9V1V5） 30S ribosomal protein S6e × 1 （Q9UYS3） 30S ribosomal protein S7 × 1 （Q9V109） 30S ribosomal protein S8 × 1 （Q9V1V0） 30S ribosomal protein S8e × 1 （Q9UZL4） 30S ribosomal protein S9 × 1 （Q9V195） 30S ribosomal protein S10 × 1 （Q9V0V6） 30S ribosomal protein S11 × 1 （P62010） 30S ribosomal protein S12 × 1 （P61994） 30S ribosomal protein S14 type Z × 1 （P62012） 30S ribosomal protein S15 × 1 （Q9V2K9） 30S ribosomal protein S17 × 1 （Q9V1U5） 30S ribosomal protein S17e × 1 （Q9V0G0） 30S ribosomal protein S19 × 1 （Q9V1T9） 30S ribosomal protein S19e × 1 （Q9V0G8） 30S ribosomal protein S24e × 1 （Q9UY20） 30S ribosomal protein S27e × 1 （Q9UXZ3） 30S ribosomal protein S28e × 1 （P61029） 30S ribosomal protein S27ae × 1 （P61238） 30S ribosomal protein S3 × 1 （Q9V1U1） 30S ribosomal protein aL41 × 1 50S ribosomal protein L7Ae × 1 （P62008） mRNA × 1 initiator Met-tRNA fMet from E. coli (A1U72 variant) × 1 Translation initiation factor 1A × 1 （Q9V138） Translation initiation factor 2 subunit gamma × 1 Translation initiation factor 2 subunit beta × 1 Translation initiation factor 2 subunit alpha × 1 （Q97Z79） MAGNESIUM ION × 34 ZINC ION × 6 METHIONINE × 1 PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1 water × 4	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS13_PYRAB
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain O； PDBConstruct 1–148； UniProt 1–148

30S ribosomal protein S14 type Z

OrganismNot specified

UniProt P62012

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 32 RNA 3	16S ribosomal rRNA × 1 30S ribosomal protein S3Ae × 1 （Q9V2K7） 30S ribosomal protein S2 × 1 （Q9V191） Zn-ribbon RNA-binding protein involved in translation × 1 （G8ZFK7） 30S ribosomal protein S4 × 1 （P61992） 30S ribosomal protein S4e × 1 （Q9V1U8） 30S ribosomal protein S5 × 1 （Q9V1V5） 30S ribosomal protein S6e × 1 （Q9UYS3） 30S ribosomal protein S7 × 1 （Q9V109） 30S ribosomal protein S8 × 1 （Q9V1V0） 30S ribosomal protein S8e × 1 （Q9UZL4） 30S ribosomal protein S9 × 1 （Q9V195） 30S ribosomal protein S10 × 1 （Q9V0V6） 30S ribosomal protein S11 × 1 （P62010） 30S ribosomal protein S12 × 1 （P61994） 30S ribosomal protein S13 × 1 （Q9V1A0） 30S ribosomal protein S15 × 1 （Q9V2K9） 30S ribosomal protein S17 × 1 （Q9V1U5） 30S ribosomal protein S17e × 1 （Q9V0G0） 30S ribosomal protein S19 × 1 （Q9V1T9） 30S ribosomal protein S19e × 1 （Q9V0G8） 30S ribosomal protein S24e × 1 （Q9UY20） 30S ribosomal protein S27e × 1 （Q9UXZ3） 30S ribosomal protein S28e × 1 （P61029） 30S ribosomal protein S27ae × 1 （P61238） 30S ribosomal protein S3 × 1 （Q9V1U1） 30S ribosomal protein aL41 × 1 50S ribosomal protein L7Ae × 1 （P62008） mRNA × 1 initiator Met-tRNA fMet from E. coli (A1U72 variant) × 1 Translation initiation factor 1A × 1 （Q9V138） Translation initiation factor 2 subunit gamma × 1 Translation initiation factor 2 subunit beta × 1 Translation initiation factor 2 subunit alpha × 1 （Q97Z79） MAGNESIUM ION × 34 ZINC ION × 6 METHIONINE × 1 PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1 water × 4	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS14Z_PYRAB
Isoform	—
PDB entities	17
Chains and sequence ranges	Author chain P； PDBConstruct 1–56； UniProt 1–56

30S ribosomal protein S15

OrganismNot specified

UniProt Q9V2K9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 32 RNA 3	16S ribosomal rRNA × 1 30S ribosomal protein S3Ae × 1 （Q9V2K7） 30S ribosomal protein S2 × 1 （Q9V191） Zn-ribbon RNA-binding protein involved in translation × 1 （G8ZFK7） 30S ribosomal protein S4 × 1 （P61992） 30S ribosomal protein S4e × 1 （Q9V1U8） 30S ribosomal protein S5 × 1 （Q9V1V5） 30S ribosomal protein S6e × 1 （Q9UYS3） 30S ribosomal protein S7 × 1 （Q9V109） 30S ribosomal protein S8 × 1 （Q9V1V0） 30S ribosomal protein S8e × 1 （Q9UZL4） 30S ribosomal protein S9 × 1 （Q9V195） 30S ribosomal protein S10 × 1 （Q9V0V6） 30S ribosomal protein S11 × 1 （P62010） 30S ribosomal protein S12 × 1 （P61994） 30S ribosomal protein S13 × 1 （Q9V1A0） 30S ribosomal protein S14 type Z × 1 （P62012） 30S ribosomal protein S17 × 1 （Q9V1U5） 30S ribosomal protein S17e × 1 （Q9V0G0） 30S ribosomal protein S19 × 1 （Q9V1T9） 30S ribosomal protein S19e × 1 （Q9V0G8） 30S ribosomal protein S24e × 1 （Q9UY20） 30S ribosomal protein S27e × 1 （Q9UXZ3） 30S ribosomal protein S28e × 1 （P61029） 30S ribosomal protein S27ae × 1 （P61238） 30S ribosomal protein S3 × 1 （Q9V1U1） 30S ribosomal protein aL41 × 1 50S ribosomal protein L7Ae × 1 （P62008） mRNA × 1 initiator Met-tRNA fMet from E. coli (A1U72 variant) × 1 Translation initiation factor 1A × 1 （Q9V138） Translation initiation factor 2 subunit gamma × 1 Translation initiation factor 2 subunit beta × 1 Translation initiation factor 2 subunit alpha × 1 （Q97Z79） MAGNESIUM ION × 34 ZINC ION × 6 METHIONINE × 1 PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1 water × 4	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS15_PYRAB
Isoform	—
PDB entities	18
Chains and sequence ranges	Author chain Q； PDBConstruct 1–158； UniProt 1–158

30S ribosomal protein S17

OrganismNot specified

UniProt Q9V1U5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 32 RNA 3	16S ribosomal rRNA × 1 30S ribosomal protein S3Ae × 1 （Q9V2K7） 30S ribosomal protein S2 × 1 （Q9V191） Zn-ribbon RNA-binding protein involved in translation × 1 （G8ZFK7） 30S ribosomal protein S4 × 1 （P61992） 30S ribosomal protein S4e × 1 （Q9V1U8） 30S ribosomal protein S5 × 1 （Q9V1V5） 30S ribosomal protein S6e × 1 （Q9UYS3） 30S ribosomal protein S7 × 1 （Q9V109） 30S ribosomal protein S8 × 1 （Q9V1V0） 30S ribosomal protein S8e × 1 （Q9UZL4） 30S ribosomal protein S9 × 1 （Q9V195） 30S ribosomal protein S10 × 1 （Q9V0V6） 30S ribosomal protein S11 × 1 （P62010） 30S ribosomal protein S12 × 1 （P61994） 30S ribosomal protein S13 × 1 （Q9V1A0） 30S ribosomal protein S14 type Z × 1 （P62012） 30S ribosomal protein S15 × 1 （Q9V2K9） 30S ribosomal protein S17e × 1 （Q9V0G0） 30S ribosomal protein S19 × 1 （Q9V1T9） 30S ribosomal protein S19e × 1 （Q9V0G8） 30S ribosomal protein S24e × 1 （Q9UY20） 30S ribosomal protein S27e × 1 （Q9UXZ3） 30S ribosomal protein S28e × 1 （P61029） 30S ribosomal protein S27ae × 1 （P61238） 30S ribosomal protein S3 × 1 （Q9V1U1） 30S ribosomal protein aL41 × 1 50S ribosomal protein L7Ae × 1 （P62008） mRNA × 1 initiator Met-tRNA fMet from E. coli (A1U72 variant) × 1 Translation initiation factor 1A × 1 （Q9V138） Translation initiation factor 2 subunit gamma × 1 Translation initiation factor 2 subunit beta × 1 Translation initiation factor 2 subunit alpha × 1 （Q97Z79） MAGNESIUM ION × 34 ZINC ION × 6 METHIONINE × 1 PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1 water × 4	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS17_PYRAB
Isoform	—
PDB entities	19
Chains and sequence ranges	Author chain R； PDBConstruct 1–113； UniProt 1–113

30S ribosomal protein S17e

OrganismNot specified

UniProt Q9V0G0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 32 RNA 3	16S ribosomal rRNA × 1 30S ribosomal protein S3Ae × 1 （Q9V2K7） 30S ribosomal protein S2 × 1 （Q9V191） Zn-ribbon RNA-binding protein involved in translation × 1 （G8ZFK7） 30S ribosomal protein S4 × 1 （P61992） 30S ribosomal protein S4e × 1 （Q9V1U8） 30S ribosomal protein S5 × 1 （Q9V1V5） 30S ribosomal protein S6e × 1 （Q9UYS3） 30S ribosomal protein S7 × 1 （Q9V109） 30S ribosomal protein S8 × 1 （Q9V1V0） 30S ribosomal protein S8e × 1 （Q9UZL4） 30S ribosomal protein S9 × 1 （Q9V195） 30S ribosomal protein S10 × 1 （Q9V0V6） 30S ribosomal protein S11 × 1 （P62010） 30S ribosomal protein S12 × 1 （P61994） 30S ribosomal protein S13 × 1 （Q9V1A0） 30S ribosomal protein S14 type Z × 1 （P62012） 30S ribosomal protein S15 × 1 （Q9V2K9） 30S ribosomal protein S17 × 1 （Q9V1U5） 30S ribosomal protein S19 × 1 （Q9V1T9） 30S ribosomal protein S19e × 1 （Q9V0G8） 30S ribosomal protein S24e × 1 （Q9UY20） 30S ribosomal protein S27e × 1 （Q9UXZ3） 30S ribosomal protein S28e × 1 （P61029） 30S ribosomal protein S27ae × 1 （P61238） 30S ribosomal protein S3 × 1 （Q9V1U1） 30S ribosomal protein aL41 × 1 50S ribosomal protein L7Ae × 1 （P62008） mRNA × 1 initiator Met-tRNA fMet from E. coli (A1U72 variant) × 1 Translation initiation factor 1A × 1 （Q9V138） Translation initiation factor 2 subunit gamma × 1 Translation initiation factor 2 subunit beta × 1 Translation initiation factor 2 subunit alpha × 1 （Q97Z79） MAGNESIUM ION × 34 ZINC ION × 6 METHIONINE × 1 PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1 water × 4	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS17E_PYRAB
Isoform	—
PDB entities	20
Chains and sequence ranges	Author chain S； PDBConstruct 1–67； UniProt 1–67

30S ribosomal protein S19

OrganismNot specified

UniProt Q9V1T9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 32 RNA 3	16S ribosomal rRNA × 1 30S ribosomal protein S3Ae × 1 （Q9V2K7） 30S ribosomal protein S2 × 1 （Q9V191） Zn-ribbon RNA-binding protein involved in translation × 1 （G8ZFK7） 30S ribosomal protein S4 × 1 （P61992） 30S ribosomal protein S4e × 1 （Q9V1U8） 30S ribosomal protein S5 × 1 （Q9V1V5） 30S ribosomal protein S6e × 1 （Q9UYS3） 30S ribosomal protein S7 × 1 （Q9V109） 30S ribosomal protein S8 × 1 （Q9V1V0） 30S ribosomal protein S8e × 1 （Q9UZL4） 30S ribosomal protein S9 × 1 （Q9V195） 30S ribosomal protein S10 × 1 （Q9V0V6） 30S ribosomal protein S11 × 1 （P62010） 30S ribosomal protein S12 × 1 （P61994） 30S ribosomal protein S13 × 1 （Q9V1A0） 30S ribosomal protein S14 type Z × 1 （P62012） 30S ribosomal protein S15 × 1 （Q9V2K9） 30S ribosomal protein S17 × 1 （Q9V1U5） 30S ribosomal protein S17e × 1 （Q9V0G0） 30S ribosomal protein S19e × 1 （Q9V0G8） 30S ribosomal protein S24e × 1 （Q9UY20） 30S ribosomal protein S27e × 1 （Q9UXZ3） 30S ribosomal protein S28e × 1 （P61029） 30S ribosomal protein S27ae × 1 （P61238） 30S ribosomal protein S3 × 1 （Q9V1U1） 30S ribosomal protein aL41 × 1 50S ribosomal protein L7Ae × 1 （P62008） mRNA × 1 initiator Met-tRNA fMet from E. coli (A1U72 variant) × 1 Translation initiation factor 1A × 1 （Q9V138） Translation initiation factor 2 subunit gamma × 1 Translation initiation factor 2 subunit beta × 1 Translation initiation factor 2 subunit alpha × 1 （Q97Z79） MAGNESIUM ION × 34 ZINC ION × 6 METHIONINE × 1 PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1 water × 4	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS19_PYRAB
Isoform	—
PDB entities	21
Chains and sequence ranges	Author chain T； PDBConstruct 1–132； UniProt 1–132

30S ribosomal protein S19e

OrganismNot specified

UniProt Q9V0G8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 32 RNA 3	16S ribosomal rRNA × 1 30S ribosomal protein S3Ae × 1 （Q9V2K7） 30S ribosomal protein S2 × 1 （Q9V191） Zn-ribbon RNA-binding protein involved in translation × 1 （G8ZFK7） 30S ribosomal protein S4 × 1 （P61992） 30S ribosomal protein S4e × 1 （Q9V1U8） 30S ribosomal protein S5 × 1 （Q9V1V5） 30S ribosomal protein S6e × 1 （Q9UYS3） 30S ribosomal protein S7 × 1 （Q9V109） 30S ribosomal protein S8 × 1 （Q9V1V0） 30S ribosomal protein S8e × 1 （Q9UZL4） 30S ribosomal protein S9 × 1 （Q9V195） 30S ribosomal protein S10 × 1 （Q9V0V6） 30S ribosomal protein S11 × 1 （P62010） 30S ribosomal protein S12 × 1 （P61994） 30S ribosomal protein S13 × 1 （Q9V1A0） 30S ribosomal protein S14 type Z × 1 （P62012） 30S ribosomal protein S15 × 1 （Q9V2K9） 30S ribosomal protein S17 × 1 （Q9V1U5） 30S ribosomal protein S17e × 1 （Q9V0G0） 30S ribosomal protein S19 × 1 （Q9V1T9） 30S ribosomal protein S24e × 1 （Q9UY20） 30S ribosomal protein S27e × 1 （Q9UXZ3） 30S ribosomal protein S28e × 1 （P61029） 30S ribosomal protein S27ae × 1 （P61238） 30S ribosomal protein S3 × 1 （Q9V1U1） 30S ribosomal protein aL41 × 1 50S ribosomal protein L7Ae × 1 （P62008） mRNA × 1 initiator Met-tRNA fMet from E. coli (A1U72 variant) × 1 Translation initiation factor 1A × 1 （Q9V138） Translation initiation factor 2 subunit gamma × 1 Translation initiation factor 2 subunit beta × 1 Translation initiation factor 2 subunit alpha × 1 （Q97Z79） MAGNESIUM ION × 34 ZINC ION × 6 METHIONINE × 1 PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1 water × 4	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS19E_PYRAB
Isoform	—
PDB entities	22
Chains and sequence ranges	Author chain U； PDBConstruct 1–150； UniProt 1–150

30S ribosomal protein S24e

OrganismNot specified

UniProt Q9UY20

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 32 RNA 3	16S ribosomal rRNA × 1 30S ribosomal protein S3Ae × 1 （Q9V2K7） 30S ribosomal protein S2 × 1 （Q9V191） Zn-ribbon RNA-binding protein involved in translation × 1 （G8ZFK7） 30S ribosomal protein S4 × 1 （P61992） 30S ribosomal protein S4e × 1 （Q9V1U8） 30S ribosomal protein S5 × 1 （Q9V1V5） 30S ribosomal protein S6e × 1 （Q9UYS3） 30S ribosomal protein S7 × 1 （Q9V109） 30S ribosomal protein S8 × 1 （Q9V1V0） 30S ribosomal protein S8e × 1 （Q9UZL4） 30S ribosomal protein S9 × 1 （Q9V195） 30S ribosomal protein S10 × 1 （Q9V0V6） 30S ribosomal protein S11 × 1 （P62010） 30S ribosomal protein S12 × 1 （P61994） 30S ribosomal protein S13 × 1 （Q9V1A0） 30S ribosomal protein S14 type Z × 1 （P62012） 30S ribosomal protein S15 × 1 （Q9V2K9） 30S ribosomal protein S17 × 1 （Q9V1U5） 30S ribosomal protein S17e × 1 （Q9V0G0） 30S ribosomal protein S19 × 1 （Q9V1T9） 30S ribosomal protein S19e × 1 （Q9V0G8） 30S ribosomal protein S27e × 1 （Q9UXZ3） 30S ribosomal protein S28e × 1 （P61029） 30S ribosomal protein S27ae × 1 （P61238） 30S ribosomal protein S3 × 1 （Q9V1U1） 30S ribosomal protein aL41 × 1 50S ribosomal protein L7Ae × 1 （P62008） mRNA × 1 initiator Met-tRNA fMet from E. coli (A1U72 variant) × 1 Translation initiation factor 1A × 1 （Q9V138） Translation initiation factor 2 subunit gamma × 1 Translation initiation factor 2 subunit beta × 1 Translation initiation factor 2 subunit alpha × 1 （Q97Z79） MAGNESIUM ION × 34 ZINC ION × 6 METHIONINE × 1 PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1 water × 4	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS24_PYRAB
Isoform	—
PDB entities	23
Chains and sequence ranges	Author chain V； PDBConstruct 1–99； UniProt 1–99

30S ribosomal protein S27e

OrganismNot specified

UniProt Q9UXZ3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 32 RNA 3	16S ribosomal rRNA × 1 30S ribosomal protein S3Ae × 1 （Q9V2K7） 30S ribosomal protein S2 × 1 （Q9V191） Zn-ribbon RNA-binding protein involved in translation × 1 （G8ZFK7） 30S ribosomal protein S4 × 1 （P61992） 30S ribosomal protein S4e × 1 （Q9V1U8） 30S ribosomal protein S5 × 1 （Q9V1V5） 30S ribosomal protein S6e × 1 （Q9UYS3） 30S ribosomal protein S7 × 1 （Q9V109） 30S ribosomal protein S8 × 1 （Q9V1V0） 30S ribosomal protein S8e × 1 （Q9UZL4） 30S ribosomal protein S9 × 1 （Q9V195） 30S ribosomal protein S10 × 1 （Q9V0V6） 30S ribosomal protein S11 × 1 （P62010） 30S ribosomal protein S12 × 1 （P61994） 30S ribosomal protein S13 × 1 （Q9V1A0） 30S ribosomal protein S14 type Z × 1 （P62012） 30S ribosomal protein S15 × 1 （Q9V2K9） 30S ribosomal protein S17 × 1 （Q9V1U5） 30S ribosomal protein S17e × 1 （Q9V0G0） 30S ribosomal protein S19 × 1 （Q9V1T9） 30S ribosomal protein S19e × 1 （Q9V0G8） 30S ribosomal protein S24e × 1 （Q9UY20） 30S ribosomal protein S28e × 1 （P61029） 30S ribosomal protein S27ae × 1 （P61238） 30S ribosomal protein S3 × 1 （Q9V1U1） 30S ribosomal protein aL41 × 1 50S ribosomal protein L7Ae × 1 （P62008） mRNA × 1 initiator Met-tRNA fMet from E. coli (A1U72 variant) × 1 Translation initiation factor 1A × 1 （Q9V138） Translation initiation factor 2 subunit gamma × 1 Translation initiation factor 2 subunit beta × 1 Translation initiation factor 2 subunit alpha × 1 （Q97Z79） MAGNESIUM ION × 34 ZINC ION × 6 METHIONINE × 1 PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1 water × 4	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS27_PYRAB
Isoform	—
PDB entities	24
Chains and sequence ranges	Author chain W； PDBConstruct 1–65； UniProt 1–65

30S ribosomal protein S28e

OrganismNot specified

UniProt P61029

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 32 RNA 3	16S ribosomal rRNA × 1 30S ribosomal protein S3Ae × 1 （Q9V2K7） 30S ribosomal protein S2 × 1 （Q9V191） Zn-ribbon RNA-binding protein involved in translation × 1 （G8ZFK7） 30S ribosomal protein S4 × 1 （P61992） 30S ribosomal protein S4e × 1 （Q9V1U8） 30S ribosomal protein S5 × 1 （Q9V1V5） 30S ribosomal protein S6e × 1 （Q9UYS3） 30S ribosomal protein S7 × 1 （Q9V109） 30S ribosomal protein S8 × 1 （Q9V1V0） 30S ribosomal protein S8e × 1 （Q9UZL4） 30S ribosomal protein S9 × 1 （Q9V195） 30S ribosomal protein S10 × 1 （Q9V0V6） 30S ribosomal protein S11 × 1 （P62010） 30S ribosomal protein S12 × 1 （P61994） 30S ribosomal protein S13 × 1 （Q9V1A0） 30S ribosomal protein S14 type Z × 1 （P62012） 30S ribosomal protein S15 × 1 （Q9V2K9） 30S ribosomal protein S17 × 1 （Q9V1U5） 30S ribosomal protein S17e × 1 （Q9V0G0） 30S ribosomal protein S19 × 1 （Q9V1T9） 30S ribosomal protein S19e × 1 （Q9V0G8） 30S ribosomal protein S24e × 1 （Q9UY20） 30S ribosomal protein S27e × 1 （Q9UXZ3） 30S ribosomal protein S27ae × 1 （P61238） 30S ribosomal protein S3 × 1 （Q9V1U1） 30S ribosomal protein aL41 × 1 50S ribosomal protein L7Ae × 1 （P62008） mRNA × 1 initiator Met-tRNA fMet from E. coli (A1U72 variant) × 1 Translation initiation factor 1A × 1 （Q9V138） Translation initiation factor 2 subunit gamma × 1 Translation initiation factor 2 subunit beta × 1 Translation initiation factor 2 subunit alpha × 1 （Q97Z79） MAGNESIUM ION × 34 ZINC ION × 6 METHIONINE × 1 PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1 water × 4	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS28_PYRAB
Isoform	—
PDB entities	25
Chains and sequence ranges	Author chain X； PDBConstruct 1–71； UniProt 1–71

30S ribosomal protein S27ae

OrganismNot specified

UniProt P61238

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 32 RNA 3	16S ribosomal rRNA × 1 30S ribosomal protein S3Ae × 1 （Q9V2K7） 30S ribosomal protein S2 × 1 （Q9V191） Zn-ribbon RNA-binding protein involved in translation × 1 （G8ZFK7） 30S ribosomal protein S4 × 1 （P61992） 30S ribosomal protein S4e × 1 （Q9V1U8） 30S ribosomal protein S5 × 1 （Q9V1V5） 30S ribosomal protein S6e × 1 （Q9UYS3） 30S ribosomal protein S7 × 1 （Q9V109） 30S ribosomal protein S8 × 1 （Q9V1V0） 30S ribosomal protein S8e × 1 （Q9UZL4） 30S ribosomal protein S9 × 1 （Q9V195） 30S ribosomal protein S10 × 1 （Q9V0V6） 30S ribosomal protein S11 × 1 （P62010） 30S ribosomal protein S12 × 1 （P61994） 30S ribosomal protein S13 × 1 （Q9V1A0） 30S ribosomal protein S14 type Z × 1 （P62012） 30S ribosomal protein S15 × 1 （Q9V2K9） 30S ribosomal protein S17 × 1 （Q9V1U5） 30S ribosomal protein S17e × 1 （Q9V0G0） 30S ribosomal protein S19 × 1 （Q9V1T9） 30S ribosomal protein S19e × 1 （Q9V0G8） 30S ribosomal protein S24e × 1 （Q9UY20） 30S ribosomal protein S27e × 1 （Q9UXZ3） 30S ribosomal protein S28e × 1 （P61029） 30S ribosomal protein S3 × 1 （Q9V1U1） 30S ribosomal protein aL41 × 1 50S ribosomal protein L7Ae × 1 （P62008） mRNA × 1 initiator Met-tRNA fMet from E. coli (A1U72 variant) × 1 Translation initiation factor 1A × 1 （Q9V138） Translation initiation factor 2 subunit gamma × 1 Translation initiation factor 2 subunit beta × 1 Translation initiation factor 2 subunit alpha × 1 （Q97Z79） MAGNESIUM ION × 34 ZINC ION × 6 METHIONINE × 1 PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1 water × 4	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS27A_PYRAB
Isoform	—
PDB entities	26
Chains and sequence ranges	Author chain Y； PDBConstruct 1–51； UniProt 1–51

30S ribosomal protein S3

OrganismNot specified

UniProt Q9V1U1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 32 RNA 3	16S ribosomal rRNA × 1 30S ribosomal protein S3Ae × 1 （Q9V2K7） 30S ribosomal protein S2 × 1 （Q9V191） Zn-ribbon RNA-binding protein involved in translation × 1 （G8ZFK7） 30S ribosomal protein S4 × 1 （P61992） 30S ribosomal protein S4e × 1 （Q9V1U8） 30S ribosomal protein S5 × 1 （Q9V1V5） 30S ribosomal protein S6e × 1 （Q9UYS3） 30S ribosomal protein S7 × 1 （Q9V109） 30S ribosomal protein S8 × 1 （Q9V1V0） 30S ribosomal protein S8e × 1 （Q9UZL4） 30S ribosomal protein S9 × 1 （Q9V195） 30S ribosomal protein S10 × 1 （Q9V0V6） 30S ribosomal protein S11 × 1 （P62010） 30S ribosomal protein S12 × 1 （P61994） 30S ribosomal protein S13 × 1 （Q9V1A0） 30S ribosomal protein S14 type Z × 1 （P62012） 30S ribosomal protein S15 × 1 （Q9V2K9） 30S ribosomal protein S17 × 1 （Q9V1U5） 30S ribosomal protein S17e × 1 （Q9V0G0） 30S ribosomal protein S19 × 1 （Q9V1T9） 30S ribosomal protein S19e × 1 （Q9V0G8） 30S ribosomal protein S24e × 1 （Q9UY20） 30S ribosomal protein S27e × 1 （Q9UXZ3） 30S ribosomal protein S28e × 1 （P61029） 30S ribosomal protein S27ae × 1 （P61238） 30S ribosomal protein aL41 × 1 50S ribosomal protein L7Ae × 1 （P62008） mRNA × 1 initiator Met-tRNA fMet from E. coli (A1U72 variant) × 1 Translation initiation factor 1A × 1 （Q9V138） Translation initiation factor 2 subunit gamma × 1 Translation initiation factor 2 subunit beta × 1 Translation initiation factor 2 subunit alpha × 1 （Q97Z79） MAGNESIUM ION × 34 ZINC ION × 6 METHIONINE × 1 PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1 water × 4	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS3_PYRAB
Isoform	—
PDB entities	27
Chains and sequence ranges	Author chain Z； PDBConstruct 1–210； UniProt 1–210

50S ribosomal protein L7Ae

OrganismNot specified

UniProt P62008

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 32 RNA 3	16S ribosomal rRNA × 1 30S ribosomal protein S3Ae × 1 （Q9V2K7） 30S ribosomal protein S2 × 1 （Q9V191） Zn-ribbon RNA-binding protein involved in translation × 1 （G8ZFK7） 30S ribosomal protein S4 × 1 （P61992） 30S ribosomal protein S4e × 1 （Q9V1U8） 30S ribosomal protein S5 × 1 （Q9V1V5） 30S ribosomal protein S6e × 1 （Q9UYS3） 30S ribosomal protein S7 × 1 （Q9V109） 30S ribosomal protein S8 × 1 （Q9V1V0） 30S ribosomal protein S8e × 1 （Q9UZL4） 30S ribosomal protein S9 × 1 （Q9V195） 30S ribosomal protein S10 × 1 （Q9V0V6） 30S ribosomal protein S11 × 1 （P62010） 30S ribosomal protein S12 × 1 （P61994） 30S ribosomal protein S13 × 1 （Q9V1A0） 30S ribosomal protein S14 type Z × 1 （P62012） 30S ribosomal protein S15 × 1 （Q9V2K9） 30S ribosomal protein S17 × 1 （Q9V1U5） 30S ribosomal protein S17e × 1 （Q9V0G0） 30S ribosomal protein S19 × 1 （Q9V1T9） 30S ribosomal protein S19e × 1 （Q9V0G8） 30S ribosomal protein S24e × 1 （Q9UY20） 30S ribosomal protein S27e × 1 （Q9UXZ3） 30S ribosomal protein S28e × 1 （P61029） 30S ribosomal protein S27ae × 1 （P61238） 30S ribosomal protein S3 × 1 （Q9V1U1） 30S ribosomal protein aL41 × 1 mRNA × 1 initiator Met-tRNA fMet from E. coli (A1U72 variant) × 1 Translation initiation factor 1A × 1 （Q9V138） Translation initiation factor 2 subunit gamma × 1 Translation initiation factor 2 subunit beta × 1 Translation initiation factor 2 subunit alpha × 1 （Q97Z79） MAGNESIUM ION × 34 ZINC ION × 6 METHIONINE × 1 PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1 water × 4	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL7A_PYRAB
Isoform	—
PDB entities	29
Chains and sequence ranges	Author chain 3； PDBConstruct 1–123； UniProt 1–123

Translation initiation factor 1A

Pyrococcus abyssi (strain GE5 / Orsay)

UniProt Q9V138

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 32 RNA 3	16S ribosomal rRNA × 1 30S ribosomal protein S3Ae × 1 （Q9V2K7） 30S ribosomal protein S2 × 1 （Q9V191） Zn-ribbon RNA-binding protein involved in translation × 1 （G8ZFK7） 30S ribosomal protein S4 × 1 （P61992） 30S ribosomal protein S4e × 1 （Q9V1U8） 30S ribosomal protein S5 × 1 （Q9V1V5） 30S ribosomal protein S6e × 1 （Q9UYS3） 30S ribosomal protein S7 × 1 （Q9V109） 30S ribosomal protein S8 × 1 （Q9V1V0） 30S ribosomal protein S8e × 1 （Q9UZL4） 30S ribosomal protein S9 × 1 （Q9V195） 30S ribosomal protein S10 × 1 （Q9V0V6） 30S ribosomal protein S11 × 1 （P62010） 30S ribosomal protein S12 × 1 （P61994） 30S ribosomal protein S13 × 1 （Q9V1A0） 30S ribosomal protein S14 type Z × 1 （P62012） 30S ribosomal protein S15 × 1 （Q9V2K9） 30S ribosomal protein S17 × 1 （Q9V1U5） 30S ribosomal protein S17e × 1 （Q9V0G0） 30S ribosomal protein S19 × 1 （Q9V1T9） 30S ribosomal protein S19e × 1 （Q9V0G8） 30S ribosomal protein S24e × 1 （Q9UY20） 30S ribosomal protein S27e × 1 （Q9UXZ3） 30S ribosomal protein S28e × 1 （P61029） 30S ribosomal protein S27ae × 1 （P61238） 30S ribosomal protein S3 × 1 （Q9V1U1） 30S ribosomal protein aL41 × 1 50S ribosomal protein L7Ae × 1 （P62008） mRNA × 1 initiator Met-tRNA fMet from E. coli (A1U72 variant) × 1 Translation initiation factor 2 subunit gamma × 1 Translation initiation factor 2 subunit beta × 1 Translation initiation factor 2 subunit alpha × 1 （Q97Z79） MAGNESIUM ION × 34 ZINC ION × 6 METHIONINE × 1 PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1 water × 4	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	IF1A_PYRAB
Isoform	—
PDB entities	32
Chains and sequence ranges	Author chain 6； PDBConstruct 1–113； UniProt 1–113

Translation initiation factor 2 subunit alpha

Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)

UniProt Q97Z79

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 32 RNA 3	16S ribosomal rRNA × 1 30S ribosomal protein S3Ae × 1 （Q9V2K7） 30S ribosomal protein S2 × 1 （Q9V191） Zn-ribbon RNA-binding protein involved in translation × 1 （G8ZFK7） 30S ribosomal protein S4 × 1 （P61992） 30S ribosomal protein S4e × 1 （Q9V1U8） 30S ribosomal protein S5 × 1 （Q9V1V5） 30S ribosomal protein S6e × 1 （Q9UYS3） 30S ribosomal protein S7 × 1 （Q9V109） 30S ribosomal protein S8 × 1 （Q9V1V0） 30S ribosomal protein S8e × 1 （Q9UZL4） 30S ribosomal protein S9 × 1 （Q9V195） 30S ribosomal protein S10 × 1 （Q9V0V6） 30S ribosomal protein S11 × 1 （P62010） 30S ribosomal protein S12 × 1 （P61994） 30S ribosomal protein S13 × 1 （Q9V1A0） 30S ribosomal protein S14 type Z × 1 （P62012） 30S ribosomal protein S15 × 1 （Q9V2K9） 30S ribosomal protein S17 × 1 （Q9V1U5） 30S ribosomal protein S17e × 1 （Q9V0G0） 30S ribosomal protein S19 × 1 （Q9V1T9） 30S ribosomal protein S19e × 1 （Q9V0G8） 30S ribosomal protein S24e × 1 （Q9UY20） 30S ribosomal protein S27e × 1 （Q9UXZ3） 30S ribosomal protein S28e × 1 （P61029） 30S ribosomal protein S27ae × 1 （P61238） 30S ribosomal protein S3 × 1 （Q9V1U1） 30S ribosomal protein aL41 × 1 50S ribosomal protein L7Ae × 1 （P62008） mRNA × 1 initiator Met-tRNA fMet from E. coli (A1U72 variant) × 1 Translation initiation factor 1A × 1 （Q9V138） Translation initiation factor 2 subunit gamma × 1 Translation initiation factor 2 subunit beta × 1 MAGNESIUM ION × 34 ZINC ION × 6 METHIONINE × 1 PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1 water × 4	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	IF2A_SACS2
Isoform	—
PDB entities	35
Chains and sequence ranges	Author chain 9； PDBConstruct 1–266； UniProt 1–266

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6swc
Deposition date deposition_date	2019-09-20
Structure title title	IC2B model of cryo-EM structure of a full archaeal ribosomal translation initiation complex devoid of aIF1 in P. abyssi
Keywords keywords	Translation initiation, cryo-EM, ribosome, tRNA, evolution, archaea, rRNA modifications; RIBOSOME
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6swc__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6swc__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6swc__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	72.09 Å
Rg (electron density)	74.03 Å
Total Rg	73.88 Å
Atom count	70702
Residues	6063
Excluded volume	1139600 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6swc__assembly_1__model_1`	35-meric （35）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (40)

Entity 1 Entity 1 polymer

Description description	16S ribosomal rRNA
Molecular weight formula_weight	487700.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	2
Atom count atom_count	70744

AUUCNGGUUGAUCCUGCCGGAGGCCACUGCUAUGGGGGUCNGACUAAGCCAUGCGAGUCAAGGGGGCGUCCCUUCUGGGACGCCACCGGCGGACGGCUCAGUAACACGUCGGUAACCUACCCUCGGGAGGGGGAUAACCCCGGGAAACUGGGGCUAAUCCCCCAUAGGCCUGGGGUACUGGAAGGUCCCCAGGCCGAAAGGGAGCCGUAAGGCUCCGCCCGAGGAUGGGCCGGCGGCCGAUUAGGUAGUUGGUGGGGUAACGGCCCACCAAGCNGAAGAUCGGUACGGGCNGUGAGAGCGGGAGCCNGGAGAUGGACACUGAGACACGGGUCCAGGCCCUACGGGGCGCAGCAGGCGCGAAACCUCNGCAAUGCGGGAAACNGCGACGGGGGGACCCCCAGUGCCGUGCCUCUGGCACGGCUUUUCCGGAGUGUAAAAAGCUCCGGGAAUAAGGGCUGGGCAAGGCNGGUGGCAGCCGCCGCGGUAAUACCGGCGGCCNGAGUGGUGGCCACUAUUAUUGGGCCUAAAGCGGCNGUAGCCGGGCCCGUAAGUCCCUGGCGAAAUCCCACGGCUCAACNGUGGGGCUCGCUGGGGAUACUGCGGGCCUUGGGACNGGGAGAGGCNGGGGGUACCCCNGGGGUAGGGGUGAAAUCCUAUAAUCCCGGGGGGACCGCCAGUGGCGAAGGCGCCNGGCUGGAACGGGUCNGACGGUGAGGGCNGAAGGCCAGGGGAGCGAACNGGAUUAGAUACCCGGGUAGUCCUGGCUGUAAAGGAUGCGGGCUAGGUGUCGGGCGAGCUUCGAGCUCGCCCGGUGCNGUAGGGAAGCNGUUAAGCCNGCNGCCUGGGGAGUACGGCNGCAAGGCUGAAACUUAAAGGAAUUGGCGGGGGAGCACUACAAGGGGUGGAGCGUGCGGUUUAAUUGGAUUCAACGCCGGGAACCUCACNGGGGGCGACGGCAGGAUGAAGGCCAGGCUGAAGGUCUUGCCGGACGCGCCGAGAGGAGGUGCAUGGCCGCNGUCAGCUCGUACNGUGAGGCGUCCACUUAAGUGUGGUAACGAGCGAGACCCGCGCCCCCAGUUGCCAGUCCCUCCCGCUCGGGAGGGAGGCACUCUGGGGGGACUGCCGGCGAUAAGCNGGAGGAAGGGGCGGGCGACGGUAGGUCAGUAUGCCCNGAAACCCCNGGGCUACACGCGCGCUACAAUGGGCGGGACAAUGGGUGCNGACCCNGAAAGGGGGAGGUAAUCCCCUAAACCCGCCCUCAGUUCGGAUCGCGGGCUGCAACUCGCCCGCGUGAAGCUGGAAUCCCUAGUACCCGCGCGUCAUCAUCGCGCGGCGAAUACGUCCCUGCUCCUUGCACACACCGCCXGUCACUCCACCCGAGCGGGGCCUAGGUGAGGCCCGAUCUCCUUCGGGAGGUCGGGUCGAGCCUAGGCUCCGUGAGGGGGGAGAAGUCGUAACAAGGUAGCNGUAGGGGAACCUACGGCUCGAUCACCUCCU

Entity 2 Entity 2 polymer

Description description	30S ribosomal protein S3Ae
Molecular weight formula_weight	22888.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A

MAAKRRVSAAKDKWKLKQWYVIYAPDFFGGVEVGLTPADDPEKVLNRVVEVTLKDITGDFLKGHVKLYFQVYDVKGQNAYTKFKGMKLARSYIRSLVRRRTTRIDGIFNITTKDGYKLRVMAMVIAARRIQTSQERAIRKIMQEIIYKKAEELNFKDFVLEAVNGKIAAEIAKEAKKIYPLKKAEIRKIKVLGEPEVAA

Entity 3 Entity 3 polymer

Description description	30S ribosomal protein S2
Molecular weight formula_weight	23026.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MADEYLVPLDQYLAAGVHIGTQQKTKDMKKFIYRVRQDGLYVLDVRKTDERLKVAGKFLARFDPQSILAVSVRLYGQKPVKKFGEVTGARAIPGRFLPGTMTNPAVKNFFEPDVIIITDPRADHQAMKEAIEIGIPIVALVDTENLLSYVDLAIPTNNKGRKALALIYWILAREILYNRGEISSREEFKIPVEEFEMKIVRR

Entity 4 Entity 4 polymer

Description description	Zn-ribbon RNA-binding protein involved in translation
Molecular weight formula_weight	7163.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

MAENVELKFEIPVCTSCGREITPREHATHFVCPNCGEAIIWRCETCRLLAKPYKCPKCGWEGP

Entity 5 Entity 5 polymer

Description description	30S ribosomal protein S4
Molecular weight formula_weight	21381.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

MGDPKRQRKKYETPPHPWIKERLDRERVLMDKYELKNKKELWKHETQLKNFRRRARRLLAARGKQAEIEREQLLARLKRLGLLPEDAVLDDVLSLTIEDILERRLQTIVYKKGLARTMRQARQLIVHGHIEVNGQIIRSPSYLVLKEEEDTITYARTSPFANPQHPERMMIEKAKQGGEA

Entity 6 Entity 6 polymer

Description description	30S ribosomal protein S4e
Molecular weight formula_weight	28246.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

MARKGPKRHLKRLAAPTSWYIERKAYKWAVRPRPGPHNMRTSIPLLYIVRDYLGYAKTAREARKILNEGKFLVDGRVRKDYKFPVGIMDVVSIPETGEHYRVLPNRIGKLILHPISEEEANIKPLRIRNKRMVKGAKIQLNFHDGTNHLIPLSEKDNYFTSYTVLMKVPEREILEVLPFEKGAYVFVTQGKNVARKGRIVEIKKFPMGWPDVVTIEDEEGELFDTLKEYAFVVGRDKPRISLP

Entity 7 Entity 7 polymer

Description description	30S ribosomal protein S5
Molecular weight formula_weight	26523.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

MSQEWKEYAKRVLDEWQPKTKLGMLVKEGQITDIHEIFRKGYQIKEPEIIDVLLPEVNARENQEILDIALTVRMTDSGRRVRFRVLAAVGNRDGYVGLGIGHGREVGIAIRKAINYAKLNIIEIKRGCGSWECRCRRPHSVPFTVEGKEGSVRVKLIPGPRGLGLVIGDVGKKILRLAGIQDVWSQTLGETRTTVNFAKAVFNALYNTNKVVVTPEMIERYGIVVGRAMPASFTLE

Entity 8 Entity 8 polymer

Description description	30S ribosomal protein S6e
Molecular weight formula_weight	14029.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

MATFKLVISDPKTGIAKQIEITGPEAEKLIGKRIGDQIPVKELGINLNELFGKEFPEDVKMEIRGGTDKDGFPMRPDIHGPRRVRILLSKGPGFRPKEKGERRKKTVRGNTISPEIVQVNVKLVY

Entity 9 Entity 9 polymer

Description description	30S ribosomal protein S7
Molecular weight formula_weight	24662.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

MAKPLSERFFIPHEIKVMGRWSTEDVEVRDPSLKPYINLEPRLLPHTHGRHAKKHFGKANVHIVERLINKIMRSGGSHYKVAGHFMRREHRSLNSKKVKAYEVVKEAFKIIEKRTGKNPIQVLVWAIENAAPREDTTSVMFGGIRYHVAVDISPMRRLDVALRNIALGASAKCYRTKMSFAEALAEEIILAANKDPKSYAYSKKLEIERIAESSR

Entity 10 Entity 10 polymer

Description description	30S ribosomal protein S8
Molecular weight formula_weight	14772.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

MTLLDPLANALSHITNSERVGKREVYIKPASKLIGEVLRVMQKYGYIGEFEFIDDGRAGVYRVQLLGKINKAGAIKPRFPVKARDYERWEKRFLPAFEFGILIVSTSQGVMSHKEAREKGIGGRLIAYVY

Entity 11 Entity 11 polymer

Description description	30S ribosomal protein S8e
Molecular weight formula_weight	14293.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

MAIWQGRSLRKPSGGRIVLARKKRKRELGREPSNTRVAEQDKRKIIRTYGGNKKVRLTAAAYANVFDKSGKGRKVRIIRVIENPANRQFARRNIITKGAIIETEIGKAKVTSRPGQDGVVNAILLEE

Entity 12 Entity 12 polymer

Description description	30S ribosomal protein S9
Molecular weight formula_weight	15293.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K

MRIIQTTGKRKTAIARAVIREGKGRVRINGKPVELVEPEIARFTILEPLILAGEEIWNSVDIDVKVQGGGFMGQAEAARIAIARALVEWTGDMNLKEKFIKYDRTMLVGDPRRTEPHKPNRSTKGPRAKRQKSYR

Entity 13 Entity 13 polymer

Description description	30S ribosomal protein S10
Molecular weight formula_weight	11795.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

MQKARIKLASTNVRSLEEVANQIKQIAERTGVRMSGPIPLPTKRIRIVTRKSPDGEGSATFDRWELRIHKRLIDIEADERAMRQIMRIRVPEDVTIEIELIS

Entity 14 Entity 14 polymer

Description description	30S ribosomal protein S11
Molecular weight formula_weight	14773.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M

MSEEQVNIKKKEKWGIAHIYSSYNNTIIHITDITGAETISRWSGGMVVKADRDEPSPYAAMLAARRAAEEALEKGIVGVHIRVRAPGGSKSKTPGPGAQAAIRALARAGLKIGRVEDVTPIPHDGTRPKGGRRGRRV

Entity 15 Entity 15 polymer

Description description	30S ribosomal protein S12
Molecular weight formula_weight	16477.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	N

MPGKKAPNGEFAGRKLKLKRKKFRWSDIRYKRRVLRLKEKSDPLEGAPQARGIVLEKIAVEAKQPNSGMRKAVRVQLIKNGKVVTAFCPGDGAIKFIDEHDEVIIEGIGGPKGGSMGDIPGIRYKVVKVNRVSLKELVKGRKEKPRR

Entity 16 Entity 16 polymer

Description description	30S ribosomal protein S13
Molecular weight formula_weight	16992.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	O

MADFRHIVRVAGVDLDGNKQLRWALTAIKGVGINFATMVCRVAGLDPFMKAGYLTDEQVKKIEEILQDPVAHGIPRWAVNRPKDYETGRDLHLITAKLDMAIREDIMRLRRIRAYRGIRHELGLPVRGQRTRSNFRRGQTVGVSRKKK

Entity 17 Entity 17 polymer

Description description	30S ribosomal protein S14 type Z
Molecular weight formula_weight	6644.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	P

MAKADYNKRKPRKFGKGARRCIRCGQYGPIIRIHGLMLCRHCFREVAPKLGFRKYE

Entity 18 Entity 18 polymer

Description description	30S ribosomal protein S15
Molecular weight formula_weight	18697.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Q

MARMHARKRGKSGSKRPPRTAPPIWLEYTVEDIENLVVKLRKEGYSTAMIGTILRDQYGIPTVKLFRDPDNPNRKLTITRILEKHGLAPEIPEDLMFLIKRAVNLRKHLEQHPKDLHSMRGLQLIESKIRRLVKYYKRKGKLPKDWRYDPEQAKLLVR

Entity 19 Entity 19 polymer

Description description	30S ribosomal protein S17
Molecular weight formula_weight	13364.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	R

MVRDIGLRIQPPAEKCDDPKCPWHGHLKIHGRVFEGIVVSDKPRKTVTVERQYYHYLKKYERYELRRSRIHAHNPPCINAKVGDRVLIAETRPLSKTKHFVVVAVLERAEERR

Entity 20 Entity 20 polymer

Description description	30S ribosomal protein S17e
Molecular weight formula_weight	8059.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	S

MGKIRQGFIKRVARELFNKYPNEFTRDFEHNKKKVEELTNVTSKKIRNRIAGYITKLVRMKEEGKIL

Entity 21 Entity 21 polymer

Description description	30S ribosomal protein S19
Molecular weight formula_weight	15307.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	T

MARKEFRYRGYTLEQLMNMSLEELAKLLPARQRRSLKRGLTPEQKKLLRKIRLAKKGKYNKPIRTHCRDMIVLPEMVGLTIYVHNGKEFVPVEIKPEMIGHYLGEFAPTRKRVQHGAPGIGATRSSMFVAVK

Entity 22 Entity 22 polymer

Description description	30S ribosomal protein S19e
Molecular weight formula_weight	17422.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	U

MATVYDVPGDLLVERVAQRLKEIPEIKPPEWAPFVKTGRHKERLPEQEDWWYYRVASILRRVYLDGPVGIERLRTYYGGRKNRGHAPERFYKAGGSIIRKALQQLEAAGFVEKVPGKGRVITPKGRSFLDKIATELKKELEEIIPELKKY

Entity 23 Entity 23 polymer

Description description	30S ribosomal protein S24e
Molecular weight formula_weight	11798.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	V

MEIKITEVKENKLIGRKEIYFEIYHPGEPTPSRKDVKGKLVAMLDLNPETTVIQYIRSYFGSYKSKGYAKYYYDKDRMLYIEPEYILIRDGIIEKKEGE

Entity 24 Entity 24 polymer

Description description	30S ribosomal protein S27e
Molecular weight formula_weight	7186.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	W

MALPRNVIPMPRSRFLRVKCIDCGNEQIVFSHPATRVRCNVCGATLVEPTGGKGIIRAKILEVLE

Entity 25 Entity 25 polymer

Description description	30S ribosomal protein S28e
Molecular weight formula_weight	8102.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	X

MAEDEGYPAEVIEIIGRTGTTGDVTQVKVRILEGRDKGRVIRRNVRGPVRVGDILILRETEREAREIKSRR

Entity 26 Entity 26 polymer

Description description	30S ribosomal protein S27ae
Molecular weight formula_weight	5992.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Y

MGQKWKLYIVKDGKVIRKNKFCPRCGPGVFMADHGDRWACGRCGYTEWKKK

Entity 27 Entity 27 polymer

Description description	30S ribosomal protein S3
Molecular weight formula_weight	23472.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Z

MAIERYFIREAVKEMLIDEFLEKELRRAGYGGLDIKKTPLGTKVIIFAANPGYVIGRGGRRIRELTRILERQFGLENPQIDVQEIKNPYLNAKVQAVRIAQALERGIHFRRAAYAAMRAIMSNGARGVEIRISGKLTGERAKSVRFYQGYLAKVGNPAETLVSKGYAQALLKLGVIGVKVAIMPPDARLPDEIEIIEKPVEEEVSSNEAE

Entity 28 Entity 28 polymer

Description description	30S ribosomal protein aL41
Molecular weight formula_weight	4910.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	0

MKRRPRKWKKKGRMRWKWIKKRIRRLKRQRKKERGL

Entity 29 Entity 29 polymer

Description description	50S ribosomal protein L7Ae
Molecular weight formula_weight	13442.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	3

MAKPSYVKFEVPKELAEKALQAVEIARDTGKIRKGTNETTKAVERGQAKLVIIAEDVDPEEIVAHLPPLCEEKEIPYIYVPSKKELGAAAGIEVAAASVAIIEPGKARDLVEEIAMKVRELMK

Entity 30 Entity 30 polymer

Description description	mRNA
Molecular weight formula_weight	6448.9 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	5

UGGAGGUGAUUUAAAUGCCA

Entity 31 Entity 31 polymer

Description description	initiator Met-tRNA fMet from E. coli (A1U72 variant)
Molecular weight formula_weight	24504.7 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	4

GCGGGGUGGAGCAGCCUGGUAGCUCGUCGGGCUCAUAACCCGAAGAUCGUCGGUUCAAAUCCGGCCCCCGCUACCA

Source Source

Source organism organism	Escherichia coli
NCBI taxonomy ID ncbi_taxonomy_id	562
Host organism host_organism	Escherichia coli

Entity 32 Entity 32 polymer

Description description	Translation initiation factor 1A
Molecular weight formula_weight	13078.3 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	6

MPKKERKVEGDEVIRVPLPEGNQLFGVVEQALGAGWMDVRCEDGKIRRCRIPGKLRRRVWIRVGDLVIVQPWPVQSDKRGDIVYRYTQTQVDWLLRKGKITQEFLTGGSLLVE

Source Source

Source organism organism	Pyrococcus abyssi (strain GE5 / Orsay)
NCBI taxonomy ID ncbi_taxonomy_id	272844
Host organism host_organism	Escherichia coli

Entity 33 Entity 33 polymer

Description description	Translation initiation factor 2 subunit gamma
Molecular weight formula_weight	45849.2 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	7

MAWPKVQPEVNIGVVGHVDHGKTTLVQAITGIWTSKHSEELKRGMTIKLGYAETNIGVCESCKKPEAYVTEPSCKSCGSDDEPKFLRRISFIDAPGHEVLMATMLSGAALMDGAILVVAANEPFPQPQTREHFVALGIIGVKNLIIVQNKVDVVSKEEALSQYRQIKQFTKGTWAENVPIIPVSALHKINIDSLIEGIEEYIKTPYRDLSQKPVMLVIRSFDVNKPGTQFNELKGGVIGGSIIQGLFKVDQEIKVLPGLRVEKQGKVSYEPIFTKISSIRFGDEEFKEAKPGGLVAIGTYLDPSLTKADNLLGSIITLADAEVPVLWNIRIKYNLLERVVGAKEMLKVDPIRAKETLMLSVGSSTTLGIVTSVKKDEIEVELRRPVAVWSNNIRTVISRQIAGRWRMIGWGLVEI

Source Source

Source organism organism	Pyrococcus abyssi GE5
NCBI taxonomy ID ncbi_taxonomy_id	272844
Host organism host_organism	Escherichia coli

Entity 34 Entity 34 polymer

Description description	Translation initiation factor 2 subunit beta
Molecular weight formula_weight	15942.7 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	8

MSSEKEYVEMLDRLYSKLPEKGRKEGTQSLPNMIILNIGNTTIIRNFAEYCDRIRREDKICMKYLLKELAAPGNVDDKGELVIQGKFSSQVINTLMERFLKAYVECSTCKSLDTILKKEKKSWYIVCLACGAQTPVKPL

Source Source

Source organism organism	Pyrococcus abyssi GE5
NCBI taxonomy ID ncbi_taxonomy_id	272844
Host organism host_organism	Escherichia coli

Entity 35 Entity 35 polymer

Description description	Translation initiation factor 2 subunit alpha
Molecular weight formula_weight	30432.4 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	9

MIYSRSKLPSEGEILIATVKQVFDYGSYVSLDEYGGLQAFLPWSEVSSKWVKNIRDVLKENRKVIVKVIRVDRRKGTVDVSLKKVTDDERRKKNLQWKKIQRLDKILELVSQKLKLSEKDAWEQVAWKLEAKYGDPITAIEKAVKEGEKILIDAGVPEIWVKPLLEEASKHAEERKVKMSGLITVRTNEPLGVEKIKEVISKALENIEQDYESLLNIKIYTIGAPRYRVDVVGTNPKEASEALNQIISNLIKIGKEENVDISVVKK

Source Source

Source organism organism	Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
NCBI taxonomy ID ncbi_taxonomy_id	273057
Host organism host_organism	Escherichia coli

Entity 36 Entity 36 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	nat
Copy count entity_count	34

Entity 37 Entity 37 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	6

Entity 38 Entity 38 non-polymer

Description description	METHIONINE
Molecular weight formula_weight	149.2 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 39 Entity 39 non-polymer

Description description	PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER
Molecular weight formula_weight	522.2 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 40 Entity 40 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	42

▼

6. Fold Classification (SCOP + CATH) 20 domains

CATH v4.4 (20 domains)

Domain ID domain_id	6swc300
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1330 — 60s Ribosomal Protein L30; Chain: A;
Homologous superfamily homologous superfamily	30 — Ribosomal protein L30/S12

Domain ID domain_id	6swc600
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	50 — OB fold (Dihydrolipoamide Acetyltransferase, E2P)
Homologous superfamily homologous superfamily	140 — Nucleic acid-binding proteins

Domain ID domain_id	6swc701
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	300 — P-loop containing nucleotide triphosphate hydrolases

Domain ID domain_id	6swc702
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	30 — Elongation Factor Tu (Ef-tu); domain 3
Homologous superfamily homologous superfamily	10 — Translation factors

Domain ID domain_id	6swc703
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	30 — Elongation Factor Tu (Ef-tu); domain 3
Homologous superfamily homologous superfamily	10 — Translation factors

Domain ID domain_id	6swc801
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	30 — Defensin A-like
Homologous superfamily homologous superfamily	170 —

Domain ID domain_id	6swcB01
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	10490 — Glucose-6-phosphate isomerase like protein; domain 1

Domain ID domain_id	6swcF01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	230 — Ribosomal Protein S5; domain 2
Homologous superfamily homologous superfamily	10 —

Domain ID domain_id	6swcH00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	455 — Ribosomal Protein S7
Homologous superfamily homologous superfamily	10 — Ribosomal protein S7/S5

Domain ID domain_id	6swcI01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1370 — Ribosomal Protein S8; Chain: A, domain 1
Homologous superfamily homologous superfamily	30 —

Domain ID domain_id	6swcI02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1490 — Dna Ligase; domain 1
Homologous superfamily homologous superfamily	10 —

Domain ID domain_id	6swcK00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	230 — Ribosomal Protein S5; domain 2
Homologous superfamily homologous superfamily	10 —

Domain ID domain_id	6swcL00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	600 — Ribosomal protein S10

Domain ID domain_id	6swcM00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	420 — Nucleotidyltransferase; domain 5
Homologous superfamily homologous superfamily	80 — Ribosomal protein S11/S14

Domain ID domain_id	6swcP00
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	830 — 30s Ribosomal Protein S14; Chain N
Homologous superfamily homologous superfamily	10 — Ribosomal Protein S14/S29

Domain ID domain_id	6swcQ02
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	10 — S15/NS1, RNA-binding

Domain ID domain_id	6swcS00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	60 — Diphtheria Toxin Repressor; domain 2
Homologous superfamily homologous superfamily	20 — Ribosomal protein S17

Domain ID domain_id	6swcV00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	330 — RRM (RNA recognition motif) domain

Domain ID domain_id	6swcW00
Class class	2 — Mainly Beta
Architecture architecture	20 — Single Sheet
Topology topology	25 — N-terminal domain of TfIIb
Homologous superfamily homologous superfamily	100 — Ribosomal protein S27

Domain ID domain_id	6swcX00
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	50 — OB fold (Dihydrolipoamide Acetyltransferase, E2P)
Homologous superfamily homologous superfamily	140 — Nucleic acid-binding proteins

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.30 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	142000

IC2B model of cryo-EM structure of a full archaeal ribosomal translation initiation complex devoid of aIF1 in P. abyssi

1. Protein Identity and Related Structures Protein Identity & Related Structures

30S ribosomal protein S3Ae

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

30S ribosomal protein S2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Zn-ribbon RNA-binding protein involved in translation

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

30S ribosomal protein S4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

30S ribosomal protein S4e

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

30S ribosomal protein S5

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

30S ribosomal protein S6e

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

30S ribosomal protein S7

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

30S ribosomal protein S8

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

30S ribosomal protein S8e

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer