SAXSdb — 4cw7

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

PUTATIVE ADENYLATE KINASE

PYROCOCCUS ABYSSI GE5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	30S RIBOSOMAL PROTEIN S11 × 1 （P62010） MAGNESIUM ION × 2 ADENOSINE-5'-DIPHOSPHATE × 1 water × 2	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 2	30S RIBOSOMAL PROTEIN S11 × 1 （P62010） ADENOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 2 water × 2	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 2	30S RIBOSOMAL PROTEIN S11 × 1 （P62010） ADENOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 2 water × 2	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 2	30S RIBOSOMAL PROTEIN S11 × 1 （P62010） MAGNESIUM ION × 2 ADENOSINE-5'-DIPHOSPHATE × 1 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	KAD6_PYRAB
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 12–191； UniProt 1–180 Author chain C； PDBConstruct 12–191； UniProt 1–180 Author chain E； PDBConstruct 12–191； UniProt 1–180 Author chain G； PDBConstruct 12–191； UniProt 1–180

30S RIBOSOMAL PROTEIN S11

PYROCOCCUS ABYSSI GE5

UniProt P62010

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	PUTATIVE ADENYLATE KINASE × 1 （Q9UZK4） MAGNESIUM ION × 2 ADENOSINE-5'-DIPHOSPHATE × 1 water × 2	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 2	PUTATIVE ADENYLATE KINASE × 1 （Q9UZK4） ADENOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 2 water × 2	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 2	PUTATIVE ADENYLATE KINASE × 1 （Q9UZK4） ADENOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 2 water × 2	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 2	PUTATIVE ADENYLATE KINASE × 1 （Q9UZK4） MAGNESIUM ION × 2 ADENOSINE-5'-DIPHOSPHATE × 1 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS11_PYRAB
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–137； UniProt 1–137 Author chain D； PDBConstruct 1–137； UniProt 1–137 Author chain F； PDBConstruct 1–137； UniProt 1–137 Author chain H； PDBConstruct 1–137； UniProt 1–137

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	4cw7
Deposition date deposition_date	2014-04-01
Structure title title	Structure of the Fap7-Rps14 complex in complex with ATP
Keywords keywords	TRANSFERASE, RIBOSOME BIOGENESIS, RNP ASSEMBLY; TRANSFERASE
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

4cw7__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

4cw7__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

4cw7__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	21.39 Å
Rg (electron density)	20.92 Å
Total Rg	21.81 Å
Atom count	2362
Residues	302
Excluded volume	42147 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`4cw7__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`4cw7__assembly_2__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`4cw7__assembly_3__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
4	1	`4cw7__assembly_4__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Description description	PUTATIVE ADENYLATE KINASE
Molecular weight formula_weight	21579.7 kDa
EC 编号 ec_number	2.7.4.3
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,C,E,G
Atom count atom_count	9454

MKHHHHHHAMGMLIAITGTPGVGKTTIAKLLAEKLGYEYVNLRDFALEKGCGREVDGEVEVEIDELAYFVEKELKDRNVVLDGHLSHLMPVDLVVVLRAHPRIIGERLRERGYSKEKIGENVEAELVDAILIEAIDEHENVIEVDTTNKTPEEIVEEIIGLIKSGVKRRVGIVDWSEVYDEIIPYLRLGGE

Source Source

Source organism organism	PYROCOCCUS ABYSSI GE5
NCBI taxonomy ID ncbi_taxonomy_id	272844
Host organism host_organism	ESCHERICHIA COLI

Entity 2 Entity 2 polymer

Description description	30S RIBOSOMAL PROTEIN S11
Molecular weight formula_weight	14773.0 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,D,F,H

MSEEQVNIKKKEKWGIAHIYSSYNNTIIHITDITGAETISRWSGGMVVKADRDEPSPYAAMLAARRAAEEALEKGIVGVHIRVRAPGGSKSKTPGPGAQAAIRALARAGLKIGRVEDVTPIPHDGTRPKGGRRGRRV

Source Source

Source organism organism	PYROCOCCUS ABYSSI GE5
NCBI taxonomy ID ncbi_taxonomy_id	272844
Host organism host_organism	ESCHERICHIA COLI

Entity 3 Entity 3 non-polymer

Description description	ADENOSINE-5'-TRIPHOSPHATE
Molecular weight formula_weight	507.2 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 4 Entity 4 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	8

Entity 5 Entity 5 non-polymer

Description description	ADENOSINE-5'-DIPHOSPHATE
Molecular weight formula_weight	427.2 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 6 Entity 6 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	130

▼

6. Fold Classification (SCOP + CATH) 8 domains

CATH v4.4 (8 domains)

Domain ID domain_id	4cw7A00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	300 — P-loop containing nucleotide triphosphate hydrolases

Domain ID domain_id	4cw7B00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	420 — Nucleotidyltransferase; domain 5
Homologous superfamily homologous superfamily	80 — Ribosomal protein S11/S14

Domain ID domain_id	4cw7C00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	300 — P-loop containing nucleotide triphosphate hydrolases

Domain ID domain_id	4cw7D00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	420 — Nucleotidyltransferase; domain 5
Homologous superfamily homologous superfamily	80 — Ribosomal protein S11/S14

Domain ID domain_id	4cw7E00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	300 — P-loop containing nucleotide triphosphate hydrolases

Domain ID domain_id	4cw7F00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	420 — Nucleotidyltransferase; domain 5
Homologous superfamily homologous superfamily	80 — Ribosomal protein S11/S14

Domain ID domain_id	4cw7G00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	300 — P-loop containing nucleotide triphosphate hydrolases

Domain ID domain_id	4cw7H00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	420 — Nucleotidyltransferase; domain 5
Homologous superfamily homologous superfamily	80 — Ribosomal protein S11/S14

▶

Unit-cell length a length_a	125.046 Å
Unit-cell length b length_b	143.079 Å
Unit-cell length c length_c	83.786 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	16

Space group space_group	P 21 21 2
Space-group number int_tables_number	18
Crystal system crystal_system	—

Resolution resolution	2.460 Å
Low-resolution limit resolution_low	41.448 Å
R factor r_factor	0.1913
R_work r_work	0.1892
R_free r_free	0.2294

Structure of the Fap7-Rps14 complex in complex with ATP

1. Protein Identity and Related Structures Protein Identity & Related Structures

PUTATIVE ADENYLATE KINASE

State in the Current Structure

Other States of the Same Protein in the Database

30S RIBOSOMAL PROTEIN S11

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

4cw7__assembly_1__model_1

4cw7__assembly_1__model_1 | I(q)

4cw7__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 water

6. Fold Classification (SCOP + CATH) 8 domains

CATH v4.4 (8 domains)

7. Citations (1)

Structure of the Fap7-Rps14 complex in complex with ATP

1. Protein Identity and Related Structures Protein Identity & Related Structures

PUTATIVE ADENYLATE KINASE

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

30S RIBOSOMAL PROTEIN S11

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

4cw7__assembly_1__model_1

4cw7__assembly_1__model_1 | I(q)

4cw7__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 water

6. Fold Classification (SCOP + CATH) 8 domains

CATH v4.4 (8 domains)

7. Citations (1)