6tcl

Photosystem I tetramer

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Photosystem I P700 chlorophyll a apoprotein A1

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 48	Photosystem I P700 chlorophyll a apoprotein A2 1 × 4 （P58565） Photosystem I iron-sulfur center × 4 （P0A410） Photosystem I reaction center subunit II × 4 （P58573） Photosystem I reaction center subunit IV × 2 （P58575） Photosystem I reaction center subunit III × 3 （P58564） Photosystem I reaction center subunit VIII × 3 （P58560） Photosystem I reaction center subunit IX × 4 （P58568） Photosystem I reaction center subunit PsaK 1 × 3 （P58583） Photosystem I reaction center subunit XI × 1 （P58577） Photosystem I reaction center subunit XII × 4 （Q8YNB0） Photosystem I 4.8 kDa protein × 4 （P58566） Photosystem I reaction center subunit III × 1 （P58564） Photosystem I reaction center subunit VIII × 1 （P58560） Photosystem I reaction center subunit PsaK 1 × 1 （P58583） Photosystem I reaction center subunit XI × 1 （P58577） Photosystem I reaction center subunit IV × 2 （P58575） Photosystem I reaction center subunit XI × 2 （P58577） CHLOROPHYLL A × 378 CHLOROPHYLL A ISOMER × 4 PHYLLOQUINONE × 8 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 24 BETA-CAROTENE × 94 Digitonin × 22 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 30 beta,beta-caroten-4-one × 4 IRON/SULFUR CLUSTER × 12 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAA_NOSS1
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–740； UniProt 12–751 Author chain A1； PDBConstruct 1–740； UniProt 12–751 Author chain A2； PDBConstruct 1–740； UniProt 12–751 Author chain AA； PDBConstruct 1–740； UniProt 12–751

Photosystem I P700 chlorophyll a apoprotein A2 1

OrganismNot specified

UniProt P58565

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 48	Photosystem I P700 chlorophyll a apoprotein A1 × 4 （P58576） Photosystem I iron-sulfur center × 4 （P0A410） Photosystem I reaction center subunit II × 4 （P58573） Photosystem I reaction center subunit IV × 2 （P58575） Photosystem I reaction center subunit III × 3 （P58564） Photosystem I reaction center subunit VIII × 3 （P58560） Photosystem I reaction center subunit IX × 4 （P58568） Photosystem I reaction center subunit PsaK 1 × 3 （P58583） Photosystem I reaction center subunit XI × 1 （P58577） Photosystem I reaction center subunit XII × 4 （Q8YNB0） Photosystem I 4.8 kDa protein × 4 （P58566） Photosystem I reaction center subunit III × 1 （P58564） Photosystem I reaction center subunit VIII × 1 （P58560） Photosystem I reaction center subunit PsaK 1 × 1 （P58583） Photosystem I reaction center subunit XI × 1 （P58577） Photosystem I reaction center subunit IV × 2 （P58575） Photosystem I reaction center subunit XI × 2 （P58577） CHLOROPHYLL A × 378 CHLOROPHYLL A ISOMER × 4 PHYLLOQUINONE × 8 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 24 BETA-CAROTENE × 94 Digitonin × 22 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 30 beta,beta-caroten-4-one × 4 IRON/SULFUR CLUSTER × 12 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAB1_NOSS1
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–739； UniProt 3–741 Author chain B1； PDBConstruct 1–739； UniProt 3–741 Author chain B2； PDBConstruct 1–739； UniProt 3–741 Author chain BB； PDBConstruct 1–739； UniProt 3–741

Photosystem I iron-sulfur center

OrganismNot specified

UniProt P0A410

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 48	Photosystem I P700 chlorophyll a apoprotein A1 × 4 （P58576） Photosystem I P700 chlorophyll a apoprotein A2 1 × 4 （P58565） Photosystem I reaction center subunit II × 4 （P58573） Photosystem I reaction center subunit IV × 2 （P58575） Photosystem I reaction center subunit III × 3 （P58564） Photosystem I reaction center subunit VIII × 3 （P58560） Photosystem I reaction center subunit IX × 4 （P58568） Photosystem I reaction center subunit PsaK 1 × 3 （P58583） Photosystem I reaction center subunit XI × 1 （P58577） Photosystem I reaction center subunit XII × 4 （Q8YNB0） Photosystem I 4.8 kDa protein × 4 （P58566） Photosystem I reaction center subunit III × 1 （P58564） Photosystem I reaction center subunit VIII × 1 （P58560） Photosystem I reaction center subunit PsaK 1 × 1 （P58583） Photosystem I reaction center subunit XI × 1 （P58577） Photosystem I reaction center subunit IV × 2 （P58575） Photosystem I reaction center subunit XI × 2 （P58577） CHLOROPHYLL A × 378 CHLOROPHYLL A ISOMER × 4 PHYLLOQUINONE × 8 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 24 BETA-CAROTENE × 94 Digitonin × 22 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 30 beta,beta-caroten-4-one × 4 IRON/SULFUR CLUSTER × 12 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAC_NOSS1
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–80； UniProt 2–81 Author chain C1； PDBConstruct 1–80； UniProt 2–81 Author chain C2； PDBConstruct 1–80； UniProt 2–81 Author chain CC； PDBConstruct 1–80； UniProt 2–81

Photosystem I reaction center subunit II

OrganismNot specified

UniProt P58573

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 48	Photosystem I P700 chlorophyll a apoprotein A1 × 4 （P58576） Photosystem I P700 chlorophyll a apoprotein A2 1 × 4 （P58565） Photosystem I iron-sulfur center × 4 （P0A410） Photosystem I reaction center subunit IV × 2 （P58575） Photosystem I reaction center subunit III × 3 （P58564） Photosystem I reaction center subunit VIII × 3 （P58560） Photosystem I reaction center subunit IX × 4 （P58568） Photosystem I reaction center subunit PsaK 1 × 3 （P58583） Photosystem I reaction center subunit XI × 1 （P58577） Photosystem I reaction center subunit XII × 4 （Q8YNB0） Photosystem I 4.8 kDa protein × 4 （P58566） Photosystem I reaction center subunit III × 1 （P58564） Photosystem I reaction center subunit VIII × 1 （P58560） Photosystem I reaction center subunit PsaK 1 × 1 （P58583） Photosystem I reaction center subunit XI × 1 （P58577） Photosystem I reaction center subunit IV × 2 （P58575） Photosystem I reaction center subunit XI × 2 （P58577） CHLOROPHYLL A × 378 CHLOROPHYLL A ISOMER × 4 PHYLLOQUINONE × 8 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 24 BETA-CAROTENE × 94 Digitonin × 22 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 30 beta,beta-caroten-4-one × 4 IRON/SULFUR CLUSTER × 12 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAD_NOSS1
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 1–134； UniProt 5–138 Author chain D1； PDBConstruct 1–134； UniProt 5–138 Author chain D2； PDBConstruct 1–134； UniProt 5–138 Author chain DD； PDBConstruct 1–134； UniProt 5–138

Photosystem I reaction center subunit IV

OrganismNot specified

UniProt P58575

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 48	Photosystem I P700 chlorophyll a apoprotein A1 × 4 （P58576） Photosystem I P700 chlorophyll a apoprotein A2 1 × 4 （P58565） Photosystem I iron-sulfur center × 4 （P0A410） Photosystem I reaction center subunit II × 4 （P58573） Photosystem I reaction center subunit III × 3 （P58564） Photosystem I reaction center subunit VIII × 3 （P58560） Photosystem I reaction center subunit IX × 4 （P58568） Photosystem I reaction center subunit PsaK 1 × 3 （P58583） Photosystem I reaction center subunit XI × 1 （P58577） Photosystem I reaction center subunit XII × 4 （Q8YNB0） Photosystem I 4.8 kDa protein × 4 （P58566） Photosystem I reaction center subunit III × 1 （P58564） Photosystem I reaction center subunit VIII × 1 （P58560） Photosystem I reaction center subunit PsaK 1 × 1 （P58583） Photosystem I reaction center subunit XI × 1 （P58577） Photosystem I reaction center subunit XI × 2 （P58577） CHLOROPHYLL A × 378 CHLOROPHYLL A ISOMER × 4 PHYLLOQUINONE × 8 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 24 BETA-CAROTENE × 94 Digitonin × 22 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 30 beta,beta-caroten-4-one × 4 IRON/SULFUR CLUSTER × 12 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAE_NOSS1
Isoform	—
PDB entities	5, 17
Chains and sequence ranges	Author chain E1； PDBConstruct 1–60； UniProt 2–61 Author chain E2； PDBConstruct 1–60； UniProt 2–61 Author chain E； PDBConstruct 1–63； UniProt 2–64 Author chain EE； PDBConstruct 1–63； UniProt 2–64

Photosystem I reaction center subunit III

OrganismNot specified

UniProt P58564

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 48	Photosystem I P700 chlorophyll a apoprotein A1 × 4 （P58576） Photosystem I P700 chlorophyll a apoprotein A2 1 × 4 （P58565） Photosystem I iron-sulfur center × 4 （P0A410） Photosystem I reaction center subunit II × 4 （P58573） Photosystem I reaction center subunit IV × 2 （P58575） Photosystem I reaction center subunit VIII × 3 （P58560） Photosystem I reaction center subunit IX × 4 （P58568） Photosystem I reaction center subunit PsaK 1 × 3 （P58583） Photosystem I reaction center subunit XI × 1 （P58577） Photosystem I reaction center subunit XII × 4 （Q8YNB0） Photosystem I 4.8 kDa protein × 4 （P58566） Photosystem I reaction center subunit VIII × 1 （P58560） Photosystem I reaction center subunit PsaK 1 × 1 （P58583） Photosystem I reaction center subunit XI × 1 （P58577） Photosystem I reaction center subunit IV × 2 （P58575） Photosystem I reaction center subunit XI × 2 （P58577） CHLOROPHYLL A × 378 CHLOROPHYLL A ISOMER × 4 PHYLLOQUINONE × 8 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 24 BETA-CAROTENE × 94 Digitonin × 22 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 30 beta,beta-caroten-4-one × 4 IRON/SULFUR CLUSTER × 12 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAF_NOSS1
Isoform	—
PDB entities	6, 13
Chains and sequence ranges	Author chain F； PDBConstruct 1–139； UniProt 25–163 Author chain F1； PDBConstruct 1–139； UniProt 25–163 Author chain FF； PDBConstruct 1–139； UniProt 25–163 Author chain F2； PDBConstruct 1–137； UniProt 25–161

Photosystem I reaction center subunit VIII

OrganismNot specified

UniProt P58560

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 48	Photosystem I P700 chlorophyll a apoprotein A1 × 4 （P58576） Photosystem I P700 chlorophyll a apoprotein A2 1 × 4 （P58565） Photosystem I iron-sulfur center × 4 （P0A410） Photosystem I reaction center subunit II × 4 （P58573） Photosystem I reaction center subunit IV × 2 （P58575） Photosystem I reaction center subunit III × 3 （P58564） Photosystem I reaction center subunit IX × 4 （P58568） Photosystem I reaction center subunit PsaK 1 × 3 （P58583） Photosystem I reaction center subunit XI × 1 （P58577） Photosystem I reaction center subunit XII × 4 （Q8YNB0） Photosystem I 4.8 kDa protein × 4 （P58566） Photosystem I reaction center subunit III × 1 （P58564） Photosystem I reaction center subunit PsaK 1 × 1 （P58583） Photosystem I reaction center subunit XI × 1 （P58577） Photosystem I reaction center subunit IV × 2 （P58575） Photosystem I reaction center subunit XI × 2 （P58577） CHLOROPHYLL A × 378 CHLOROPHYLL A ISOMER × 4 PHYLLOQUINONE × 8 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 24 BETA-CAROTENE × 94 Digitonin × 22 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 30 beta,beta-caroten-4-one × 4 IRON/SULFUR CLUSTER × 12 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAI_NOSS1
Isoform	—
PDB entities	7, 14
Chains and sequence ranges	Author chain I； PDBConstruct 1–31； UniProt 13–43 Author chain I1； PDBConstruct 1–31； UniProt 13–43 Author chain II； PDBConstruct 1–31； UniProt 13–43 Author chain I2； PDBConstruct 1–33； UniProt 13–45

Photosystem I reaction center subunit IX

OrganismNot specified

UniProt P58568

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 48	Photosystem I P700 chlorophyll a apoprotein A1 × 4 （P58576） Photosystem I P700 chlorophyll a apoprotein A2 1 × 4 （P58565） Photosystem I iron-sulfur center × 4 （P0A410） Photosystem I reaction center subunit II × 4 （P58573） Photosystem I reaction center subunit IV × 2 （P58575） Photosystem I reaction center subunit III × 3 （P58564） Photosystem I reaction center subunit VIII × 3 （P58560） Photosystem I reaction center subunit PsaK 1 × 3 （P58583） Photosystem I reaction center subunit XI × 1 （P58577） Photosystem I reaction center subunit XII × 4 （Q8YNB0） Photosystem I 4.8 kDa protein × 4 （P58566） Photosystem I reaction center subunit III × 1 （P58564） Photosystem I reaction center subunit VIII × 1 （P58560） Photosystem I reaction center subunit PsaK 1 × 1 （P58583） Photosystem I reaction center subunit XI × 1 （P58577） Photosystem I reaction center subunit IV × 2 （P58575） Photosystem I reaction center subunit XI × 2 （P58577） CHLOROPHYLL A × 378 CHLOROPHYLL A ISOMER × 4 PHYLLOQUINONE × 8 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 24 BETA-CAROTENE × 94 Digitonin × 22 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 30 beta,beta-caroten-4-one × 4 IRON/SULFUR CLUSTER × 12 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAJ_NOSS1
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain J； PDBConstruct 1–48； UniProt 2–49 Author chain J1； PDBConstruct 1–48； UniProt 2–49 Author chain J2； PDBConstruct 1–48； UniProt 2–49 Author chain JJ； PDBConstruct 1–48； UniProt 2–49

Photosystem I reaction center subunit PsaK 1

OrganismNot specified

UniProt P58583

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 48	Photosystem I P700 chlorophyll a apoprotein A1 × 4 （P58576） Photosystem I P700 chlorophyll a apoprotein A2 1 × 4 （P58565） Photosystem I iron-sulfur center × 4 （P0A410） Photosystem I reaction center subunit II × 4 （P58573） Photosystem I reaction center subunit IV × 2 （P58575） Photosystem I reaction center subunit III × 3 （P58564） Photosystem I reaction center subunit VIII × 3 （P58560） Photosystem I reaction center subunit IX × 4 （P58568） Photosystem I reaction center subunit XI × 1 （P58577） Photosystem I reaction center subunit XII × 4 （Q8YNB0） Photosystem I 4.8 kDa protein × 4 （P58566） Photosystem I reaction center subunit III × 1 （P58564） Photosystem I reaction center subunit VIII × 1 （P58560） Photosystem I reaction center subunit XI × 1 （P58577） Photosystem I reaction center subunit IV × 2 （P58575） Photosystem I reaction center subunit XI × 2 （P58577） CHLOROPHYLL A × 378 CHLOROPHYLL A ISOMER × 4 PHYLLOQUINONE × 8 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 24 BETA-CAROTENE × 94 Digitonin × 22 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 30 beta,beta-caroten-4-one × 4 IRON/SULFUR CLUSTER × 12 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAK1_NOSS1
Isoform	—
PDB entities	9, 15
Chains and sequence ranges	Author chain K； PDBConstruct 1–74； UniProt 9–82 Author chain K1； PDBConstruct 1–74； UniProt 9–82 Author chain KK； PDBConstruct 1–74； UniProt 9–82 Author chain K2； PDBConstruct 1–73； UniProt 10–82

Photosystem I reaction center subunit XI

OrganismNot specified

UniProt P58577

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 48	Photosystem I P700 chlorophyll a apoprotein A1 × 4 （P58576） Photosystem I P700 chlorophyll a apoprotein A2 1 × 4 （P58565） Photosystem I iron-sulfur center × 4 （P0A410） Photosystem I reaction center subunit II × 4 （P58573） Photosystem I reaction center subunit IV × 2 （P58575） Photosystem I reaction center subunit III × 3 （P58564） Photosystem I reaction center subunit VIII × 3 （P58560） Photosystem I reaction center subunit IX × 4 （P58568） Photosystem I reaction center subunit PsaK 1 × 3 （P58583） Photosystem I reaction center subunit XII × 4 （Q8YNB0） Photosystem I 4.8 kDa protein × 4 （P58566） Photosystem I reaction center subunit III × 1 （P58564） Photosystem I reaction center subunit VIII × 1 （P58560） Photosystem I reaction center subunit PsaK 1 × 1 （P58583） Photosystem I reaction center subunit IV × 2 （P58575） CHLOROPHYLL A × 378 CHLOROPHYLL A ISOMER × 4 PHYLLOQUINONE × 8 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 24 BETA-CAROTENE × 94 Digitonin × 22 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 30 beta,beta-caroten-4-one × 4 IRON/SULFUR CLUSTER × 12 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAL_NOSS1
Isoform	—
PDB entities	10, 16, 18
Chains and sequence ranges	Author chain L1； PDBConstruct 1–166； UniProt 2–167 Author chain L2； PDBConstruct 1–167； UniProt 2–168 Author chain L； PDBConstruct 1–154； UniProt 17–170 Author chain LL； PDBConstruct 1–154； UniProt 17–170

Photosystem I reaction center subunit XII

OrganismNot specified

UniProt Q8YNB0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 48	Photosystem I P700 chlorophyll a apoprotein A1 × 4 （P58576） Photosystem I P700 chlorophyll a apoprotein A2 1 × 4 （P58565） Photosystem I iron-sulfur center × 4 （P0A410） Photosystem I reaction center subunit II × 4 （P58573） Photosystem I reaction center subunit IV × 2 （P58575） Photosystem I reaction center subunit III × 3 （P58564） Photosystem I reaction center subunit VIII × 3 （P58560） Photosystem I reaction center subunit IX × 4 （P58568） Photosystem I reaction center subunit PsaK 1 × 3 （P58583） Photosystem I reaction center subunit XI × 1 （P58577） Photosystem I 4.8 kDa protein × 4 （P58566） Photosystem I reaction center subunit III × 1 （P58564） Photosystem I reaction center subunit VIII × 1 （P58560） Photosystem I reaction center subunit PsaK 1 × 1 （P58583） Photosystem I reaction center subunit XI × 1 （P58577） Photosystem I reaction center subunit IV × 2 （P58575） Photosystem I reaction center subunit XI × 2 （P58577） CHLOROPHYLL A × 378 CHLOROPHYLL A ISOMER × 4 PHYLLOQUINONE × 8 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 24 BETA-CAROTENE × 94 Digitonin × 22 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 30 beta,beta-caroten-4-one × 4 IRON/SULFUR CLUSTER × 12 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAM_NOSS1
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain M； PDBConstruct 1–31； UniProt 2–32 Author chain M1； PDBConstruct 1–31； UniProt 2–32 Author chain M2； PDBConstruct 1–31； UniProt 2–32 Author chain MM； PDBConstruct 1–31； UniProt 2–32

Photosystem I 4.8 kDa protein

OrganismNot specified

UniProt P58566

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 48	Photosystem I P700 chlorophyll a apoprotein A1 × 4 （P58576） Photosystem I P700 chlorophyll a apoprotein A2 1 × 4 （P58565） Photosystem I iron-sulfur center × 4 （P0A410） Photosystem I reaction center subunit II × 4 （P58573） Photosystem I reaction center subunit IV × 2 （P58575） Photosystem I reaction center subunit III × 3 （P58564） Photosystem I reaction center subunit VIII × 3 （P58560） Photosystem I reaction center subunit IX × 4 （P58568） Photosystem I reaction center subunit PsaK 1 × 3 （P58583） Photosystem I reaction center subunit XI × 1 （P58577） Photosystem I reaction center subunit XII × 4 （Q8YNB0） Photosystem I reaction center subunit III × 1 （P58564） Photosystem I reaction center subunit VIII × 1 （P58560） Photosystem I reaction center subunit PsaK 1 × 1 （P58583） Photosystem I reaction center subunit XI × 1 （P58577） Photosystem I reaction center subunit IV × 2 （P58575） Photosystem I reaction center subunit XI × 2 （P58577） CHLOROPHYLL A × 378 CHLOROPHYLL A ISOMER × 4 PHYLLOQUINONE × 8 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 24 BETA-CAROTENE × 94 Digitonin × 22 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 30 beta,beta-caroten-4-one × 4 IRON/SULFUR CLUSTER × 12 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAX_NOSS1
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain X； PDBConstruct 1–39； UniProt 5–43 Author chain X1； PDBConstruct 1–39； UniProt 5–43 Author chain X2； PDBConstruct 1–39； UniProt 5–43 Author chain XX； PDBConstruct 1–39； UniProt 5–43

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6tcl
Deposition date deposition_date	2019-11-06
Structure title title	Photosystem I tetramer
Keywords keywords	photosynthesis, tetramer, anabaena, PSI; PHOTOSYNTHESIS
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6tcl__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6tcl__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6tcl__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	85.55 Å
Rg (electron density)	85.01 Å
Total Rg	84.92 Å
Atom count	199152
Residues	9058
Excluded volume	1864000 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6tcl__assembly_1__model_1`	48-meric （48）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (28)

Entity 1 Entity 1 polymer

Description description	Photosystem I P700 chlorophyll a apoprotein A1
Molecular weight formula_weight	81932.1 kDa
EC 编号 ec_number	1.97.1.12
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A1,A2,A,AA
Atom count atom_count	199181

KARVIVDKDPVPTSFEKWAQPGHFDRTLARGPKTTTWIWNLHALAHDFDTHTSDLEDISRKIFAAHFGHLAVVTIWLSGMIFHGAKFSNYEAWLSDPLNVRPSAQVVWPIVGQDILNGDVGGGFHGIQITSGLFQVWRGWGITNSFQLYCTAIGGLVLAGLFLFAGWFHYHKRAPKLEWFQNVESMLNHHLQVLLGCGSLGWAGHLIHVSAPINKLMDAGVAVKDIPLPHEFILNKSLLIDLFPGFAAGLTPFFTLNWGQYADFLTFKGGLNPVTGGLWMTDIAHHHLAIAVVFIIAGHQYRTNWGIGHSIKEILENHKGPFTGEGHKGLYENLTTSWHAQLATNLAFLGSLTIIIAHHMYAMPPYPYLATDYATQLCIFTHHIWIGGFLIVGGAAHAAIFMVRDYDPVVNQNNVLDRVIRHRDAIISHLNWVCIFLGFHSFGLYIHNDTMRALGRPQDMFSDTAIQLQPVFAQWVQNLHTLAPGGTAPNALEPVSYAFGGGVLAVGGKVAMMPIALGTADFLIHHIHAFTIHVTVLILLKGVLFARSSRLIPDKANLGFRFPCDGPGRGGTCQVSGWDHVFLGLFWMYNSLSIVIFHFSWKMQSDVWGTVDAAGNVSHITGGNFAQSAITINGWLRDFLWAQASQVINSYGSALSAYGLMFLGAHFVWAFSLMFLFSGRGYWQELIESIVWAHNKLKVAPAIQPRALSITQGRAVGVAHYLLGGIATTWAFFHAHILSV

Entity 2 Entity 2 polymer

Description description	Photosystem I P700 chlorophyll a apoprotein A2 1
Molecular weight formula_weight	83254.7 kDa
EC 编号 ec_number	1.97.1.12
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B1,B2,B,BB

TKFPKFSQDLAQDPTTRRIWYAMAMGNDFESHDGMTEENLYQKIFATHFGHLAIIFLWASSLLFHVAWQGNFEQWIKDPLHVRPIAHAIWDPHFGKPAIEAFTQAGANGPVNIAYSGVYHWWYTIGMRTNTELYTGSVFLLLFASLFLFAGWLHLQPKFRPSLAWFKSAESRLNHHLAGLFGVSSLAWAGHLIHVAIPESRGQHVGWDNFLSTAPHPAGLQPFFTGNWGVYAQNPDTAGHIFSTSQGAGTAILTFLGGFHPQTESLWLTDMAHHHLAIAVLFIVAGHMYRTNFGIGHSIKEMMNAKTFFGKPVEGPFNMPHQGIYDTYNNSLHFQLGWHLACLGVVTSWVAQHMYSLPSYAFIAKDYTTQAALYTHHQYIAIFLMVGAFAHGAIFLVRDYDPEQNKGNVLERVLQHKEAIISHLSWVSLFLGFHTLGLYVHNDVVVAFGTPEKQILIEPVFAQFIQAAHGKVLYGLDTLLSNPDSVAYTAYPNYANVWLPGWLDAINSGTNSLFLTIGPGDFLVHHAIALGLHTTTLILVKGALDARGSKLMPDKKDFGYAFPCDGPGRGGTCDISAWDSFYLSLFWALNTVGWVTFYWHWKHLGIWQGNVAQFNENSTYLMGWFRDYLWANSAQLINGYNPYGVNNLSVWAWMFLFGHLVWATGFMFLISWRGYWQELIETLVWAHERTPIANLVRWKDKPVALSIVQARVVGLAHFTVGYVLTYAAFLIASTAGKFG

Entity 3 Entity 3 polymer

Description description	Photosystem I iron-sulfur center
Molecular weight formula_weight	8694.0 kDa
EC 编号 ec_number	1.97.1.12
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C1,C2,C,CC

SHTVKIYDTCIGCTQCVRACPTDVLEMVPWDGCKAAQVASSPRTEDCVGCKRCETACPTDFLSIRVYLGAETTRSMGLAY

Entity 4 Entity 4 polymer

Description description	Photosystem I reaction center subunit II
Molecular weight formula_weight	14672.7 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D1,D2,D,DD

LSGKTPLFAGSTGGLLTKAVEEEKYAITWTSPKAQVFELPTGGAATMHEGENLLYIARKEYGIALGGQLRKFKITNYKIYRILPSGETTFIHPADGVFPEKVNAGREKVRFNARSIGENPNPSQVKFSGKATYD

Entity 5 Entity 5 polymer

Description description	Photosystem I reaction center subunit IV
Molecular weight formula_weight	6809.7 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E1,E2

VQRGSKVRILRPESYWFQDVGTVASVDQSGIKYPVIVRFDKVNYAGINTNNFAVDELIEV

Entity 6 Entity 6 polymer

Description description	Photosystem I reaction center subunit III
Molecular weight formula_weight	15030.0 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F1,F,FF

GADLTPCAENPAFQALAKNARNTTADPQSGQKRFERYSQALCGPEGYPHLIVDGRLDRAGDFLIPSILFLYIAGWIGWVGRAYLQAIKKDSDTEQKEIQLDLGIALPIIATGFAWPAAAVKELLSGELTAKDSEITVSP

Entity 7 Entity 7 polymer

Description description	Photosystem I reaction center subunit VIII
Molecular weight formula_weight	3550.2 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I1,I,II

ASFLSSIFVPVIGWVVPIATFSFLFLYIERE

Entity 8 Entity 8 polymer

Description description	Photosystem I reaction center subunit IX
Molecular weight formula_weight	5368.2 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J1,J2,J,JJ

ADKADQSSYLIKFISTAPVAATIWLTITAGILIEFNRFFPDLLFHPLP

Entity 9 Entity 9 polymer

Description description	Photosystem I reaction center subunit PsaK 1
Molecular weight formula_weight	7580.9 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K1,K,KK

AATTPLEWSPTVGIIMVIANVIAITFGRQTIKYPSAEPALPSAKFFGGFGAPALLATTAFGHILGVGLVLGLHN

Entity 10 Entity 10 polymer

Description description	Photosystem I reaction center subunit XI
Molecular weight formula_weight	17545.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L1

AQAVDASKNLPSDPRNREVVFPAGRDPQWGNLETPVNASPLVKWFINNLPAYRPGLTPFRRGLEVGMAHGYFLFGPFAKLGPLRDAANANLAGLLGAIGLVVLFTLALSLYANSNPPTALASVTVPNPPDAFQSKEGWNNFASAFLIGGIGGAVVAYFLTSNLALI

Entity 11 Entity 11 polymer

Description description	Photosystem I reaction center subunit XII
Molecular weight formula_weight	3407.0 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M1,M2,M,MM

SSISDTQVYIALVVALIPGLLAWRLATELYK

Entity 12 Entity 12 polymer

Description description	Photosystem I 4.8 kDa protein
Molecular weight formula_weight	4342.1 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	X1,X2,X,XX

KISPVANTGAKPPYTFRTGWALLLLAVNFLVAAYYFHII

Entity 13 Entity 13 polymer

Description description	Photosystem I reaction center subunit III
Molecular weight formula_weight	14845.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F2

GADLTPCAENPAFQALAKNARNTTADPQSGQKRFERYSQALCGPEGYPHLIVDGRLDRAGDFLIPSILFLYIAGWIGWVGRAYLQAIKKDSDTEQKEIQLDLGIALPIIATGFAWPAAAVKELLSGELTAKDSEITV

Entity 14 Entity 14 polymer

Description description	Photosystem I reaction center subunit VIII
Molecular weight formula_weight	3764.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I2

ASFLSSIFVPVIGWVVPIATFSFLFLYIEREDV

Entity 15 Entity 15 polymer

Description description	Photosystem I reaction center subunit PsaK 1
Molecular weight formula_weight	7509.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K2

ATTPLEWSPTVGIIMVIANVIAITFGRQTIKYPSAEPALPSAKFFGGFGAPALLATTAFGHILGVGLVLGLHN

Entity 16 Entity 16 polymer

Description description	Photosystem I reaction center subunit XI
Molecular weight formula_weight	17673.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L2

AQAVDASKNLPSDPRNREVVFPAGRDPQWGNLETPVNASPLVKWFINNLPAYRPGLTPFRRGLEVGMAHGYFLFGPFAKLGPLRDAANANLAGLLGAIGLVVLFTLALSLYANSNPPTALASVTVPNPPDAFQSKEGWNNFASAFLIGGIGGAVVAYFLTSNLALIQ

Entity 17 Entity 17 polymer

Description description	Photosystem I reaction center subunit IV
Molecular weight formula_weight	7107.0 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,EE

VQRGSKVRILRPESYWFQDVGTVASVDQSGIKYPVIVRFDKVNYAGINTNNFAVDELIEVEAP

Entity 18 Entity 18 polymer

Description description	Photosystem I reaction center subunit XI
Molecular weight formula_weight	16290.7 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L,LL

NREVVFPAGRDPQWGNLETPVNASPLVKWFINNLPAYRPGLTPFRRGLEVGMAHGYFLFGPFAKLGPLRDAANANLAGLLGAIGLVVLFTLALSLYANSNPPTALASVTVPNPPDAFQSKEGWNNFASAFLIGGIGGAVVAYFLTSNLALIQGL

Entity 19 Entity 19 non-polymer

Description description	CHLOROPHYLL A
Molecular weight formula_weight	893.5 kDa
Source method src_method	syn
Copy count entity_count	378

Entity 20 Entity 20 non-polymer

Description description	CHLOROPHYLL A ISOMER
Molecular weight formula_weight	893.5 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 21 Entity 21 non-polymer

Description description	PHYLLOQUINONE
Molecular weight formula_weight	450.7 kDa
Source method src_method	syn
Copy count entity_count	8

Entity 22 Entity 22 non-polymer

Description description	1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE
Molecular weight formula_weight	723.0 kDa
Source method src_method	syn
Copy count entity_count	24

Entity 23 Entity 23 non-polymer

Description description	BETA-CAROTENE
Molecular weight formula_weight	536.9 kDa
Source method src_method	syn
Copy count entity_count	94

Entity 24 Entity 24 non-polymer

Description description	Digitonin
Molecular weight formula_weight	1229.3 kDa
Source method src_method	syn
Copy count entity_count	22

Entity 25 Entity 25 non-polymer

Description description	1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE
Molecular weight formula_weight	787.2 kDa
Source method src_method	syn
Copy count entity_count	30

Entity 26 Entity 26 non-polymer

Description description	beta,beta-caroten-4-one
Molecular weight formula_weight	550.9 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 27 Entity 27 non-polymer

Description description	IRON/SULFUR CLUSTER
Molecular weight formula_weight	351.6 kDa
Source method src_method	syn
Copy count entity_count	12

Entity 28 Entity 28 non-polymer

Description description	DIGALACTOSYL DIACYL GLYCEROL (DGDG)
Molecular weight formula_weight	949.3 kDa
Source method src_method	syn
Copy count entity_count	2

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	triclinic

Resolution resolution	3.20 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	69247

Photosystem I tetramer

1. Protein Identity and Related Structures Protein Identity & Related Structures

Photosystem I P700 chlorophyll a apoprotein A1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I P700 chlorophyll a apoprotein A2 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I iron-sulfur center

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit II

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit IV

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit III

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit VIII

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit IX

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit PsaK 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit XI

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer