SAXSdb — 6tpj

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Orexin receptor type 2,GlgA glycogen synthase,Hypocretin receptor-2

Homo sapiens

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Monomer	Protein 1	OLEIC ACID × 13 [(7R)-4-(5-chloro-1,3-benzoxazol-2-yl)-7-methyl-1,4-diazepan-1-yl][5-methyl-2-(2H-1,2,3-triazol-2-yl)phenyl]methanone × 1 AMMONIUM ION × 2 TETRAETHYLENE GLYCOL × 1 water × 1	Consistent with protein count
2	Insufficient information	Monomer	Protein 1	OLEIC ACID × 21 [(7R)-4-(5-chloro-1,3-benzoxazol-2-yl)-7-methyl-1,4-diazepan-1-yl][5-methyl-2-(2H-1,2,3-triazol-2-yl)phenyl]methanone × 1 AMMONIUM ION × 3 TETRAETHYLENE GLYCOL × 1 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	OX2R_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 12–265； UniProt 1–254 Author chain B； PDBConstruct 12–265； UniProt 1–254

Orexin receptor type 2,GlgA glycogen synthase,Hypocretin receptor-2

Homo sapiens

UniProt Q548Y0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Monomer	Protein 1	OLEIC ACID × 13 [(7R)-4-(5-chloro-1,3-benzoxazol-2-yl)-7-methyl-1,4-diazepan-1-yl][5-methyl-2-(2H-1,2,3-triazol-2-yl)phenyl]methanone × 1 AMMONIUM ION × 2 TETRAETHYLENE GLYCOL × 1 water × 1	Consistent with protein count
2	Insufficient information	Monomer	Protein 1	OLEIC ACID × 21 [(7R)-4-(5-chloro-1,3-benzoxazol-2-yl)-7-methyl-1,4-diazepan-1-yl][5-methyl-2-(2H-1,2,3-triazol-2-yl)phenyl]methanone × 1 AMMONIUM ION × 3 TETRAETHYLENE GLYCOL × 1 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q548Y0_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 462–556； UniProt 294–388 Author chain B； PDBConstruct 462–556； UniProt 294–388

Orexin receptor type 2,GlgA glycogen synthase,Hypocretin receptor-2

Homo sapiens

UniProt Q9V2J8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Monomer	Protein 1	OLEIC ACID × 13 [(7R)-4-(5-chloro-1,3-benzoxazol-2-yl)-7-methyl-1,4-diazepan-1-yl][5-methyl-2-(2H-1,2,3-triazol-2-yl)phenyl]methanone × 1 AMMONIUM ION × 2 TETRAETHYLENE GLYCOL × 1 water × 1	Consistent with protein count
2	Insufficient information	Monomer	Protein 1	OLEIC ACID × 21 [(7R)-4-(5-chloro-1,3-benzoxazol-2-yl)-7-methyl-1,4-diazepan-1-yl][5-methyl-2-(2H-1,2,3-triazol-2-yl)phenyl]methanone × 1 AMMONIUM ION × 3 TETRAETHYLENE GLYCOL × 1 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q9V2J8_PYRAB
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 266–461； UniProt 218–413 Author chain B； PDBConstruct 266–461； UniProt 218–413

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6tpj
Deposition date deposition_date	2019-12-13
Structure title title	Crystal structure of the Orexin-2 receptor in complex with suvorexant at 2.76 A resolution
Keywords keywords	7TM, GPCR, MEMBRANE PROTEIN; MEMBRANE PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6tpj__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6tpj__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6tpj__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	32.32 Å
Rg (electron density)	32.10 Å
Total Rg	32.31 Å
Atom count	4171
Residues	498
Excluded volume	75996 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6tpj__assembly_1__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`6tpj__assembly_2__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Description description	Orexin receptor type 2,GlgA glycogen synthase,Hypocretin receptor-2
Molecular weight formula_weight	64520.1 kDa
Mutation mutation	E54A Y91L D100A V142A R170L L206A Y219A M233A A242L L310V L318A T347A N14D N22D N202D C381W C382W C383W
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	8644

QDLDYKDDDDKMSGTKLEDSPPCRDWSSASELDETQEPLLDPTDYDDEEFLRYLWREYLHPKEYAWVLIAGYIIVFVVALIGNVLVCVAVWKNHHMRTVTNLFIVNLSLAAVLVTITCLPATLVVDITETWFFGQSLCKVIPYLQTVSVSVSALTLSCIALDRWYAICHPLMFKSTAKRALNSIVIIWIVSCIIMIPQAIVMECSTVFPGLADKTTAFTVCDERWGGEIAPKMYHICFFLVTYAAPLCLMVLLYLQIFRKLWCRQGIDCSFWNESYLTGSRDERKKSLLSKFGMDEGVTFMFIGRFDRGQKGVDVLLKAIEILSSKKEFQEMRFIIIGKGDPELEGWARSLEEKHGNVKVITEMLSREFVRELYGSVDFVIIPSYFEPFGLVALEAMCLGAIPIASAVGGLRDIITNETGILVKAGDPGELANAILKALELSRSDLSKFRENCKKRAMSFSKQIRARRKTARMLMVVVLVFAICYAPISILNVLKRVFGMFAHTEDRETVYAWFAFSHWLVYANSAANPIIYNFLSGKFREEFKAAFSWWWLGVHHHHHHHHHH

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Spodoptera frugiperda

Entity 2 Entity 2 non-polymer

Description description	OLEIC ACID
Molecular weight formula_weight	282.5 kDa
Source method src_method	syn
Copy count entity_count	34

Entity 3 Entity 3 non-polymer

Description description	[(7R)-4-(5-chloro-1,3-benzoxazol-2-yl)-7-methyl-1,4-diazepan-1-yl][5-methyl-2-(2H-1,2,3-triazol-2-yl)phenyl]methanone
Molecular weight formula_weight	450.9 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 4 Entity 4 non-polymer

Description description	AMMONIUM ION
Molecular weight formula_weight	18.0 kDa
Source method src_method	syn
Copy count entity_count	5

Entity 5 Entity 5 non-polymer

Description description	TETRAETHYLENE GLYCOL
Molecular weight formula_weight	194.2 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 6 Entity 6 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	226

▶

Unit-cell length a length_a	55.325 Å
Unit-cell length b length_b	76.247 Å
Unit-cell length c length_c	82.737 Å
Unit-cell angle α angle_alpha	89.99 °
Unit-cell angle β angle_beta	85.25 °
Unit-cell angle γ angle_gamma	89.97 °
Molecules per unit cell Z z_pdb	2

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	2.740 Å
Low-resolution limit resolution_low	47.695 Å
R factor r_factor	0.2092
R_work r_work	0.2071
R_free r_free	0.2536

Crystal structure of the Orexin-2 receptor in complex with suvorexant at 2.76 A resolution

1. Protein Identity and Related Structures Protein Identity & Related Structures

Orexin receptor type 2,GlgA glycogen synthase,Hypocretin receptor-2

State in the Current Structure

Other States of the Same Protein in the Database

Orexin receptor type 2,GlgA glycogen synthase,Hypocretin receptor-2

State in the Current Structure

Other States of the Same Protein in the Database

Orexin receptor type 2,GlgA glycogen synthase,Hypocretin receptor-2

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6tpj__assembly_1__model_1

6tpj__assembly_1__model_1 | I(q)

6tpj__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 water

7. Citations (1)

Crystal structure of the Orexin-2 receptor in complex with suvorexant at 2.76 A resolution

1. Protein Identity and Related Structures Protein Identity & Related Structures

Orexin receptor type 2,GlgA glycogen synthase,Hypocretin receptor-2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Orexin receptor type 2,GlgA glycogen synthase,Hypocretin receptor-2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Orexin receptor type 2,GlgA glycogen synthase,Hypocretin receptor-2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6tpj__assembly_1__model_1

6tpj__assembly_1__model_1 | I(q)

6tpj__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 water

7. Citations (1)