SAXSdb — 6xy4

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

anti-apoptotic membrane protein

Sheeppox virus (strain Turkey/TU-V02127)

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	Activator of apoptosis harakiri × 1 （O00198） water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A3F2YKH3_SHEVT
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 6–150； UniProt 1–145

Activator of apoptosis harakiri

OrganismNot specified

UniProt O00198

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	anti-apoptotic membrane protein × 1 （A0A3F2YKH3） water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	HRK_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–26； UniProt 26–51

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6xy4
Deposition date deposition_date	2020-01-29
Structure title title	Structural insight into sheep-pox virus mediated inhibition of apoptosis
Keywords keywords	Pox virus, Apoptosis, Bcl-2; APOPTOSIS
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6xy4__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6xy4__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6xy4__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	16.75 Å
Rg (electron density)	15.10 Å
Total Rg	16.25 Å
Atom count	2436
Residues	151
Excluded volume	22078 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6xy4__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	anti-apoptotic membrane protein
Molecular weight formula_weight	17476.0 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	2477

GPLGSMDNCNYNIEKVLNVYLRDLRIESLNNNELEILIMIRECCEVIKKDYKTEFNEICNFILQNNVKSCYDINDVKNIIIETINSDFRPSVILASISLLSIIIKKKKDENNEVVDDDLALNELINKFSSYQKDIISFVEKNKKKNKQND

Source Source

Source organism organism	Sheeppox virus (strain Turkey/TU-V02127)
NCBI taxonomy ID ncbi_taxonomy_id	654928
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 2 Entity 2 polymer

Description description	Activator of apoptosis harakiri
Molecular weight formula_weight	2973.4 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

RSSAAQLTAARLKALGDELHQRTMWR

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	28

▼

6. Fold Classification (SCOP + CATH) 1 domains

CATH v4.4 (1 domains)

Domain ID domain_id	6xy4A01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	437 — Apoptosis Regulator Bcl-x
Homologous superfamily homologous superfamily	10 — Blc2-like

▶

Unit-cell length a length_a	43.280 Å
Unit-cell length b length_b	70.660 Å
Unit-cell length c length_c	115.080 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	C 2 2 21
Space-group number int_tables_number	20
Crystal system crystal_system	orthorhombic

Resolution resolution	2.046 Å
Low-resolution limit resolution_low	31.066 Å
R factor r_factor	0.2206
R_work r_work	0.2199
R_free r_free	0.2338

Structural insight into sheep-pox virus mediated inhibition of apoptosis

1. Protein Identity and Related Structures Protein Identity & Related Structures

anti-apoptotic membrane protein

State in the Current Structure

Other States of the Same Protein in the Database

Activator of apoptosis harakiri

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6xy4__assembly_1__model_1

6xy4__assembly_1__model_1 | I(q)

6xy4__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 1 domains

CATH v4.4 (1 domains)

7. Citations (1)

Structural insight into sheep-pox virus mediated inhibition of apoptosis

1. Protein Identity and Related Structures Protein Identity & Related Structures

anti-apoptotic membrane protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Activator of apoptosis harakiri

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6xy4__assembly_1__model_1

6xy4__assembly_1__model_1 | I(q)

6xy4__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 1 domains

CATH v4.4 (1 domains)

7. Citations (1)