SAXSdb — 6zbu

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Nuclear receptor corepressor 1,B-cell lymphoma 6 protein

Homo sapiens

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 12	SULFATE ION × 28 GLYCEROL × 4 water × 10	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NCOR1_HUMAN
Isoform	—
PDB entities	1, 2
Chains and sequence ranges	Author chain A； PDBConstruct 3–11； UniProt 1733–1741 Author chain B； PDBConstruct 3–11； UniProt 1733–1741 Author chain E； PDBConstruct 3–11； UniProt 1733–1741 Author chain F； PDBConstruct 3–11； UniProt 1733–1741 Author chain I； PDBConstruct 3–11； UniProt 1733–1741 Author chain J； PDBConstruct 3–11； UniProt 1733–1741 Author chain C； PDBConstruct 1–17； UniProt 1340–1356 Author chain D； PDBConstruct 1–17； UniProt 1340–1356 Author chain G； PDBConstruct 1–17； UniProt 1340–1356 Author chain H； PDBConstruct 1–17； UniProt 1340–1356 Author chain K； PDBConstruct 1–17； UniProt 1340–1356 Author chain L； PDBConstruct 1–17； UniProt 1340–1356

Nuclear receptor corepressor 1,B-cell lymphoma 6 protein

Homo sapiens

UniProt P41182

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 12	Nuclear receptor corepressor 1 × 6 （O75376） SULFATE ION × 28 GLYCEROL × 4 water × 10	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	BCL6_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 14–137； UniProt 6–129 Author chain B； PDBConstruct 14–137； UniProt 6–129 Author chain E； PDBConstruct 14–137； UniProt 6–129 Author chain F； PDBConstruct 14–137； UniProt 6–129 Author chain I； PDBConstruct 14–137； UniProt 6–129 Author chain J； PDBConstruct 14–137； UniProt 6–129

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6zbu
Deposition date deposition_date	2020-06-09
Structure title title	Crystal structure of an NCoR1BBD2-BCL6BTB chimera in complex with the NcoR1 BBD1 corepressor peptide
Keywords keywords	BCL6, NCoR1., TRANSCRIPTION; TRANSCRIPTION
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6zbu__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6zbu__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6zbu__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	38.33 Å
Rg (electron density)	38.51 Å
Total Rg	38.65 Å
Atom count	7276
Residues	883
Excluded volume	129420 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6zbu__assembly_1__model_1`	dodecameric （12）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	Nuclear receptor corepressor 1,B-cell lymphoma 6 protein
Molecular weight formula_weight	15603.0 kDa
Source method src_method	man
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,E,F,I,J
Atom count atom_count	7421

GPSSDLYLRPGGGDSQIQFTRHASDVLLNLNRLRSRDILTDVVIVVSREQFRAHKTVLMACSGLFYSIFTDQLKRNLSVINLDPEINPEGFNILLDFMYTSRLNLREGNIMAVMATAMYLQMEHVVDTCRKFIKASE

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Nuclear receptor corepressor 1
Molecular weight formula_weight	1942.3 kDa
Source method src_method	syn
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,D,G,K,L,H

GITTIKEMGRSIHEIPR

Entity 3 Entity 3 non-polymer

Description description	SULFATE ION
Molecular weight formula_weight	96.1 kDa
Source method src_method	syn
Copy count entity_count	28

Entity 4 Entity 4 non-polymer

Description description	GLYCEROL
Molecular weight formula_weight	92.1 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 5 Entity 5 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	120

▶

Unit-cell length a length_a	198.575 Å
Unit-cell length b length_b	198.575 Å
Unit-cell length c length_c	113.067 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	48

Space group space_group	P 41 21 2
Space-group number int_tables_number	92
Crystal system crystal_system	tetragonal

Resolution resolution	2.460 Å
Low-resolution limit resolution_low	88.810 Å
R factor r_factor	0.2260
R_work r_work	0.2243
R_free r_free	0.2593

Crystal structure of an NCoR1BBD2-BCL6BTB chimera in complex with the NcoR1 BBD1 corepressor peptide

1. Protein Identity and Related Structures Protein Identity & Related Structures

Nuclear receptor corepressor 1,B-cell lymphoma 6 protein

State in the Current Structure

Other States of the Same Protein in the Database

Nuclear receptor corepressor 1,B-cell lymphoma 6 protein

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6zbu__assembly_1__model_1

6zbu__assembly_1__model_1 | I(q)

6zbu__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 water

7. Citations (1)

Crystal structure of an NCoR1BBD2-BCL6BTB chimera in complex with the NcoR1 BBD1 corepressor peptide

1. Protein Identity and Related Structures Protein Identity & Related Structures

Nuclear receptor corepressor 1,B-cell lymphoma 6 protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Nuclear receptor corepressor 1,B-cell lymphoma 6 protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6zbu__assembly_1__model_1

6zbu__assembly_1__model_1 | I(q)

6zbu__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 water

7. Citations (1)