6zk9

Peripheral domain of open complex I during turnover

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 18	Mitochondrial complex I, 24 kDa subunit × 1 （W5NRY1） NADH:ubiquinone oxidoreductase core subunit S1 × 1 （W5QB34） Mitochondrial complex I, 49 kDa subunit × 1 NADH:ubiquinone oxidoreductase core subunit S3 × 1 （W5PB27） Mitochondrial complex I, PSST subunit × 1 Mitochondrial complex I, TYKY subunit × 1 Mitochondrial complex I, 10 kDa subunit × 1 Mitochondrial complex I, 13 kDa subunit × 1 NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （W5PE07） NADH:ubiquinone oxidoreductase subunit A9 × 1 （W5PI58） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （W5QAH8） Mitochondrial complex I, B13 subunit × 1 （W5PNX7） NADH:ubiquinone oxidoreductase subunit A6 × 1 （W5QC06） Mitochondrial complex I, B14.5a subunit × 1 （W5P0I2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （B9VGZ9） Acyl carrier protein × 1 （W5NQT7） Mitochondrial complex I, B16.6 subunit × 1 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 1,4-DIHYDRONICOTINAMIDE ADENINE DINUCLEOTIDE × 1 FE2/S2 (INORGANIC) CLUSTER × 2 POTASSIUM ION × 1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2 1,2-Distearoyl-sn-glycerophosphoethanolamine × 2 ZINC ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1 CARDIOLIPIN × 1 water × 17	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	W5PUX0_SHEEP
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain 1； PDBConstruct 1–464； UniProt 1–464

Mitochondrial complex I, 24 kDa subunit

OrganismNot specified

UniProt W5NRY1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 18	NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （W5PUX0） NADH:ubiquinone oxidoreductase core subunit S1 × 1 （W5QB34） Mitochondrial complex I, 49 kDa subunit × 1 NADH:ubiquinone oxidoreductase core subunit S3 × 1 （W5PB27） Mitochondrial complex I, PSST subunit × 1 Mitochondrial complex I, TYKY subunit × 1 Mitochondrial complex I, 10 kDa subunit × 1 Mitochondrial complex I, 13 kDa subunit × 1 NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （W5PE07） NADH:ubiquinone oxidoreductase subunit A9 × 1 （W5PI58） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （W5QAH8） Mitochondrial complex I, B13 subunit × 1 （W5PNX7） NADH:ubiquinone oxidoreductase subunit A6 × 1 （W5QC06） Mitochondrial complex I, B14.5a subunit × 1 （W5P0I2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （B9VGZ9） Acyl carrier protein × 1 （W5NQT7） Mitochondrial complex I, B16.6 subunit × 1 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 1,4-DIHYDRONICOTINAMIDE ADENINE DINUCLEOTIDE × 1 FE2/S2 (INORGANIC) CLUSTER × 2 POTASSIUM ION × 1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2 1,2-Distearoyl-sn-glycerophosphoethanolamine × 2 ZINC ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1 CARDIOLIPIN × 1 water × 17	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	W5NRY1_SHEEP
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain 2； PDBConstruct 1–246； UniProt 1–246

NADH:ubiquinone oxidoreductase core subunit S1

OrganismNot specified

UniProt W5QB34

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 18	NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （W5PUX0） Mitochondrial complex I, 24 kDa subunit × 1 （W5NRY1） Mitochondrial complex I, 49 kDa subunit × 1 NADH:ubiquinone oxidoreductase core subunit S3 × 1 （W5PB27） Mitochondrial complex I, PSST subunit × 1 Mitochondrial complex I, TYKY subunit × 1 Mitochondrial complex I, 10 kDa subunit × 1 Mitochondrial complex I, 13 kDa subunit × 1 NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （W5PE07） NADH:ubiquinone oxidoreductase subunit A9 × 1 （W5PI58） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （W5QAH8） Mitochondrial complex I, B13 subunit × 1 （W5PNX7） NADH:ubiquinone oxidoreductase subunit A6 × 1 （W5QC06） Mitochondrial complex I, B14.5a subunit × 1 （W5P0I2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （B9VGZ9） Acyl carrier protein × 1 （W5NQT7） Mitochondrial complex I, B16.6 subunit × 1 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 1,4-DIHYDRONICOTINAMIDE ADENINE DINUCLEOTIDE × 1 FE2/S2 (INORGANIC) CLUSTER × 2 POTASSIUM ION × 1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2 1,2-Distearoyl-sn-glycerophosphoethanolamine × 2 ZINC ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1 CARDIOLIPIN × 1 water × 17	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	W5QB34_SHEEP
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain 3； PDBConstruct 1–727； UniProt 1–727

NADH:ubiquinone oxidoreductase core subunit S3

OrganismNot specified

UniProt W5PB27

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 18	NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （W5PUX0） Mitochondrial complex I, 24 kDa subunit × 1 （W5NRY1） NADH:ubiquinone oxidoreductase core subunit S1 × 1 （W5QB34） Mitochondrial complex I, 49 kDa subunit × 1 Mitochondrial complex I, PSST subunit × 1 Mitochondrial complex I, TYKY subunit × 1 Mitochondrial complex I, 10 kDa subunit × 1 Mitochondrial complex I, 13 kDa subunit × 1 NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （W5PE07） NADH:ubiquinone oxidoreductase subunit A9 × 1 （W5PI58） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （W5QAH8） Mitochondrial complex I, B13 subunit × 1 （W5PNX7） NADH:ubiquinone oxidoreductase subunit A6 × 1 （W5QC06） Mitochondrial complex I, B14.5a subunit × 1 （W5P0I2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （B9VGZ9） Acyl carrier protein × 1 （W5NQT7） Mitochondrial complex I, B16.6 subunit × 1 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 1,4-DIHYDRONICOTINAMIDE ADENINE DINUCLEOTIDE × 1 FE2/S2 (INORGANIC) CLUSTER × 2 POTASSIUM ION × 1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2 1,2-Distearoyl-sn-glycerophosphoethanolamine × 2 ZINC ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1 CARDIOLIPIN × 1 water × 17	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	W5PB27_SHEEP
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain 5； PDBConstruct 1–266； UniProt 1–266

NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial

OrganismNot specified

UniProt W5PE07

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 18	NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （W5PUX0） Mitochondrial complex I, 24 kDa subunit × 1 （W5NRY1） NADH:ubiquinone oxidoreductase core subunit S1 × 1 （W5QB34） Mitochondrial complex I, 49 kDa subunit × 1 NADH:ubiquinone oxidoreductase core subunit S3 × 1 （W5PB27） Mitochondrial complex I, PSST subunit × 1 Mitochondrial complex I, TYKY subunit × 1 Mitochondrial complex I, 10 kDa subunit × 1 Mitochondrial complex I, 13 kDa subunit × 1 NADH:ubiquinone oxidoreductase subunit A9 × 1 （W5PI58） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （W5QAH8） Mitochondrial complex I, B13 subunit × 1 （W5PNX7） NADH:ubiquinone oxidoreductase subunit A6 × 1 （W5QC06） Mitochondrial complex I, B14.5a subunit × 1 （W5P0I2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （B9VGZ9） Acyl carrier protein × 1 （W5NQT7） Mitochondrial complex I, B16.6 subunit × 1 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 1,4-DIHYDRONICOTINAMIDE ADENINE DINUCLEOTIDE × 1 FE2/S2 (INORGANIC) CLUSTER × 2 POTASSIUM ION × 1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2 1,2-Distearoyl-sn-glycerophosphoethanolamine × 2 ZINC ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1 CARDIOLIPIN × 1 water × 17	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	W5PE07_SHEEP
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain c； PDBConstruct 1–170； UniProt 1–170

NADH:ubiquinone oxidoreductase subunit A9

OrganismNot specified

UniProt W5PI58

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 18	NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （W5PUX0） Mitochondrial complex I, 24 kDa subunit × 1 （W5NRY1） NADH:ubiquinone oxidoreductase core subunit S1 × 1 （W5QB34） Mitochondrial complex I, 49 kDa subunit × 1 NADH:ubiquinone oxidoreductase core subunit S3 × 1 （W5PB27） Mitochondrial complex I, PSST subunit × 1 Mitochondrial complex I, TYKY subunit × 1 Mitochondrial complex I, 10 kDa subunit × 1 Mitochondrial complex I, 13 kDa subunit × 1 NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （W5PE07） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （W5QAH8） Mitochondrial complex I, B13 subunit × 1 （W5PNX7） NADH:ubiquinone oxidoreductase subunit A6 × 1 （W5QC06） Mitochondrial complex I, B14.5a subunit × 1 （W5P0I2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （B9VGZ9） Acyl carrier protein × 1 （W5NQT7） Mitochondrial complex I, B16.6 subunit × 1 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 1,4-DIHYDRONICOTINAMIDE ADENINE DINUCLEOTIDE × 1 FE2/S2 (INORGANIC) CLUSTER × 2 POTASSIUM ION × 1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2 1,2-Distearoyl-sn-glycerophosphoethanolamine × 2 ZINC ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1 CARDIOLIPIN × 1 water × 17	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	W5PI58_SHEEP
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain d； PDBConstruct 1–380； UniProt 1–380

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2

OrganismNot specified

UniProt W5QAH8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 18	NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （W5PUX0） Mitochondrial complex I, 24 kDa subunit × 1 （W5NRY1） NADH:ubiquinone oxidoreductase core subunit S1 × 1 （W5QB34） Mitochondrial complex I, 49 kDa subunit × 1 NADH:ubiquinone oxidoreductase core subunit S3 × 1 （W5PB27） Mitochondrial complex I, PSST subunit × 1 Mitochondrial complex I, TYKY subunit × 1 Mitochondrial complex I, 10 kDa subunit × 1 Mitochondrial complex I, 13 kDa subunit × 1 NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （W5PE07） NADH:ubiquinone oxidoreductase subunit A9 × 1 （W5PI58） Mitochondrial complex I, B13 subunit × 1 （W5PNX7） NADH:ubiquinone oxidoreductase subunit A6 × 1 （W5QC06） Mitochondrial complex I, B14.5a subunit × 1 （W5P0I2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （B9VGZ9） Acyl carrier protein × 1 （W5NQT7） Mitochondrial complex I, B16.6 subunit × 1 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 1,4-DIHYDRONICOTINAMIDE ADENINE DINUCLEOTIDE × 1 FE2/S2 (INORGANIC) CLUSTER × 2 POTASSIUM ION × 1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2 1,2-Distearoyl-sn-glycerophosphoethanolamine × 2 ZINC ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1 CARDIOLIPIN × 1 water × 17	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	W5QAH8_SHEEP
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain e； PDBConstruct 1–99； UniProt 1–99

Mitochondrial complex I, B13 subunit

OrganismNot specified

UniProt W5PNX7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 18	NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （W5PUX0） Mitochondrial complex I, 24 kDa subunit × 1 （W5NRY1） NADH:ubiquinone oxidoreductase core subunit S1 × 1 （W5QB34） Mitochondrial complex I, 49 kDa subunit × 1 NADH:ubiquinone oxidoreductase core subunit S3 × 1 （W5PB27） Mitochondrial complex I, PSST subunit × 1 Mitochondrial complex I, TYKY subunit × 1 Mitochondrial complex I, 10 kDa subunit × 1 Mitochondrial complex I, 13 kDa subunit × 1 NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （W5PE07） NADH:ubiquinone oxidoreductase subunit A9 × 1 （W5PI58） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （W5QAH8） NADH:ubiquinone oxidoreductase subunit A6 × 1 （W5QC06） Mitochondrial complex I, B14.5a subunit × 1 （W5P0I2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （B9VGZ9） Acyl carrier protein × 1 （W5NQT7） Mitochondrial complex I, B16.6 subunit × 1 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 1,4-DIHYDRONICOTINAMIDE ADENINE DINUCLEOTIDE × 1 FE2/S2 (INORGANIC) CLUSTER × 2 POTASSIUM ION × 1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2 1,2-Distearoyl-sn-glycerophosphoethanolamine × 2 ZINC ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1 CARDIOLIPIN × 1 water × 17	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	W5PNX7_SHEEP
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain f； PDBConstruct 1–116； UniProt 1–116

NADH:ubiquinone oxidoreductase subunit A6

OrganismNot specified

UniProt W5QC06

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 18	NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （W5PUX0） Mitochondrial complex I, 24 kDa subunit × 1 （W5NRY1） NADH:ubiquinone oxidoreductase core subunit S1 × 1 （W5QB34） Mitochondrial complex I, 49 kDa subunit × 1 NADH:ubiquinone oxidoreductase core subunit S3 × 1 （W5PB27） Mitochondrial complex I, PSST subunit × 1 Mitochondrial complex I, TYKY subunit × 1 Mitochondrial complex I, 10 kDa subunit × 1 Mitochondrial complex I, 13 kDa subunit × 1 NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （W5PE07） NADH:ubiquinone oxidoreductase subunit A9 × 1 （W5PI58） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （W5QAH8） Mitochondrial complex I, B13 subunit × 1 （W5PNX7） Mitochondrial complex I, B14.5a subunit × 1 （W5P0I2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （B9VGZ9） Acyl carrier protein × 1 （W5NQT7） Mitochondrial complex I, B16.6 subunit × 1 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 1,4-DIHYDRONICOTINAMIDE ADENINE DINUCLEOTIDE × 1 FE2/S2 (INORGANIC) CLUSTER × 2 POTASSIUM ION × 1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2 1,2-Distearoyl-sn-glycerophosphoethanolamine × 2 ZINC ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1 CARDIOLIPIN × 1 water × 17	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	W5QC06_SHEEP
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain g； PDBConstruct 1–140； UniProt 1–140

Mitochondrial complex I, B14.5a subunit

OrganismNot specified

UniProt W5P0I2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 18	NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （W5PUX0） Mitochondrial complex I, 24 kDa subunit × 1 （W5NRY1） NADH:ubiquinone oxidoreductase core subunit S1 × 1 （W5QB34） Mitochondrial complex I, 49 kDa subunit × 1 NADH:ubiquinone oxidoreductase core subunit S3 × 1 （W5PB27） Mitochondrial complex I, PSST subunit × 1 Mitochondrial complex I, TYKY subunit × 1 Mitochondrial complex I, 10 kDa subunit × 1 Mitochondrial complex I, 13 kDa subunit × 1 NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （W5PE07） NADH:ubiquinone oxidoreductase subunit A9 × 1 （W5PI58） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （W5QAH8） Mitochondrial complex I, B13 subunit × 1 （W5PNX7） NADH:ubiquinone oxidoreductase subunit A6 × 1 （W5QC06） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （B9VGZ9） Acyl carrier protein × 1 （W5NQT7） Mitochondrial complex I, B16.6 subunit × 1 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 1,4-DIHYDRONICOTINAMIDE ADENINE DINUCLEOTIDE × 1 FE2/S2 (INORGANIC) CLUSTER × 2 POTASSIUM ION × 1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2 1,2-Distearoyl-sn-glycerophosphoethanolamine × 2 ZINC ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1 CARDIOLIPIN × 1 water × 17	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	W5P0I2_SHEEP
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain h； PDBConstruct 1–114； UniProt 1–114

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12

OrganismNot specified

UniProt B9VGZ9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 18	NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （W5PUX0） Mitochondrial complex I, 24 kDa subunit × 1 （W5NRY1） NADH:ubiquinone oxidoreductase core subunit S1 × 1 （W5QB34） Mitochondrial complex I, 49 kDa subunit × 1 NADH:ubiquinone oxidoreductase core subunit S3 × 1 （W5PB27） Mitochondrial complex I, PSST subunit × 1 Mitochondrial complex I, TYKY subunit × 1 Mitochondrial complex I, 10 kDa subunit × 1 Mitochondrial complex I, 13 kDa subunit × 1 NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （W5PE07） NADH:ubiquinone oxidoreductase subunit A9 × 1 （W5PI58） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （W5QAH8） Mitochondrial complex I, B13 subunit × 1 （W5PNX7） NADH:ubiquinone oxidoreductase subunit A6 × 1 （W5QC06） Mitochondrial complex I, B14.5a subunit × 1 （W5P0I2） Acyl carrier protein × 1 （W5NQT7） Mitochondrial complex I, B16.6 subunit × 1 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 1,4-DIHYDRONICOTINAMIDE ADENINE DINUCLEOTIDE × 1 FE2/S2 (INORGANIC) CLUSTER × 2 POTASSIUM ION × 1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2 1,2-Distearoyl-sn-glycerophosphoethanolamine × 2 ZINC ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1 CARDIOLIPIN × 1 water × 17	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	B9VGZ9_SHEEP
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain i； PDBConstruct 1–145； UniProt 1–145

Acyl carrier protein

OrganismNot specified

UniProt W5NQT7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 18	NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （W5PUX0） Mitochondrial complex I, 24 kDa subunit × 1 （W5NRY1） NADH:ubiquinone oxidoreductase core subunit S1 × 1 （W5QB34） Mitochondrial complex I, 49 kDa subunit × 1 NADH:ubiquinone oxidoreductase core subunit S3 × 1 （W5PB27） Mitochondrial complex I, PSST subunit × 1 Mitochondrial complex I, TYKY subunit × 1 Mitochondrial complex I, 10 kDa subunit × 1 Mitochondrial complex I, 13 kDa subunit × 1 NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （W5PE07） NADH:ubiquinone oxidoreductase subunit A9 × 1 （W5PI58） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （W5QAH8） Mitochondrial complex I, B13 subunit × 1 （W5PNX7） NADH:ubiquinone oxidoreductase subunit A6 × 1 （W5QC06） Mitochondrial complex I, B14.5a subunit × 1 （W5P0I2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （B9VGZ9） Mitochondrial complex I, B16.6 subunit × 1 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 1,4-DIHYDRONICOTINAMIDE ADENINE DINUCLEOTIDE × 1 FE2/S2 (INORGANIC) CLUSTER × 2 POTASSIUM ION × 1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2 1,2-Distearoyl-sn-glycerophosphoethanolamine × 2 ZINC ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1 CARDIOLIPIN × 1 water × 17	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	W5NQT7_SHEEP
Isoform	—
PDB entities	17
Chains and sequence ranges	Author chain j； PDBConstruct 1–157； UniProt 1–157

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6zk9
Deposition date deposition_date	2020-06-30
Structure title title	Peripheral domain of open complex I during turnover
Keywords keywords	complex, respiration, NADH, proton pump, mitochondria, iron-sulphur cluster, oxidoreductase, membrane protein, ELECTRON TRANSPORT; ELECTRON TRANSPORT
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6zk9__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6zk9__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6zk9__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	48.15 Å
Rg (electron density)	48.30 Å
Total Rg	48.30 Å
Atom count	28115
Residues	3478
Excluded volume	502300 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6zk9__assembly_1__model_1`	octadecameric （18）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (30)

Entity 1 Entity 1 polymer

Description description	NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial
Molecular weight formula_weight	50687.8 kDa
EC 编号 ec_number	1.6.99.3,7.1.1.2
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	1
Atom count atom_count	29587

MLAARRLLGGSLPARVSVRFSGDTTAPKKTSFGSLKDEDRIFTNLYGRHDWRLKGAQSRGDWYKTKEILLKGPDWILGEVKTSGLRGRGGAGFPTGLKWSFMNKPSDGRPKYLVVNADEGEPGTCKDREIIRHDPHKLVEGCLVGGRAMGARAAYIYIRGEFYNEASNLQVAIREAYEAGLIGKNACGSGYDFDVFVVRGAGAYICGEETALIESIEGKQGKPRLKPPFPADVGVFGCPTTVANVETVAVSPTICRRGGAWFASFGRERNSGTKLFNISGHVNNPCTVEEEMSVPLKELIEKHAGGVTGGWDNLLAVIPGGSSTPLIPKSVCETVLMDFDALIQAQTGLGTAAVIVMDRSTDIVKAIARLIEFYKHESCGQCTPCREGVDWMNKVMARFVRGDARPAEIDSLWEISKQIEGHTICALGDGAAWPVQGLIRHFRPELEERMQRFAQQHQARQAAS

Entity 2 Entity 2 polymer

Description description	Mitochondrial complex I, 24 kDa subunit
Molecular weight formula_weight	27373.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	2

MPVLQYEHLEECIRWGKHIRNLHKTAVQNGAGGALFVHRDTPKNNPETPFDFTPENYKRIEAIVKNYPEGHKAAAVLPVLDLAQRQNGWLPISAMNKVAEILQVPPMRVYEVATFYTMYNRKPVGKYHIQVCTTTPCMLRNSDSILEAIQKKLGIKVGETTPDKLFTLIEVECLGACVNAPMVQINDNYYEDLTPKDIEEIIDELKAGKIPKPGPRSGRFSCEPAGGLTSLTEPPKGPGFGVQAGL

Entity 3 Entity 3 polymer

Description description	NADH:ubiquinone oxidoreductase core subunit S1
Molecular weight formula_weight	79519.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	3

MLRIPVRKALVGLSKSSKGCVRTTATAASNLIEVFVDGQSVMVEPGTTVLQACEKVGMQIPRFCYHERLSVAGNCRMCLVEIEKAPKVVAACAMPVMKGWNILTNSEKTKKAREGVMEFLLANHPLDCPICDQGGECDLQDQSMMFGSDRSRFLEGKRAVEDKNIGPLVKTIMTRCIQCTRCIRFASEIAGVDDLGTTGRGNDMQVGTYIEKMFMSELSGNIIDICPVGALTSKPYAFTARPWETRKTESIDVMDAVGSNIVVSTRTGEVMRILPRMHEDINEEWISDKTRFAYDGLKRQRLTEPMVRNEKGLLTHTTWEDALSRVAGMLQSCQGNDVAAIAGGLVDAEALIALKDLLNRVDSDTLCTEEVFPTAGAGTDLRSNYLLNTTIAGVEEADVVLLVGTNPRFEAPLFNARIRKSWLHNDLKVALIGSPVDLTYRYDHLGDSPKILQDIASGSHPFSQVLQEAKKPMVVLGSSALQRNDGAAILAAVSNIAQKIRTSSGVTGDWKVMNILHRIASQVAALDLGYKPGVEAIRKNPPKMLFLLGADGGCVTRQDLPKDCFIVYQGHHGDVGAPIADVILPGAAYTEKSATYVNTEGRAQQTKVAVMPPGLAREDWKIIRALSEIAGMTLPYDTLDQVRNRLEEVSPNLVRYDDVEGANYFQQASELSKLVNQQLLADPLVPPQLTIKDFYMTDSISRASQTMAKCVKAVTEGAHAVEEPSIC

Entity 4 Entity 4 polymer

Description description	Mitochondrial complex I, 49 kDa subunit
Molecular weight formula_weight	52661.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	4

MAALRALRRLRGAAAQVLRPGAGARLPIQPSRGARQWQPDVEWAEQYGGAVMYPTKETAHWKPPPWNDVDPPKDTLVSNLTLNFGPQHPAAHGVLRLVMELSGEMVRKCDPHIGLLHRGTEKLIEYKTYLQALPYFDRLDYVSMMCNEQAYSLAVEKLLNIQPPPRAQWIRVLFGEITRLLNHIMAVTTHALDIGAMTPFFWMFEEREKMFEFYERVSGARMHAAYVRPGGVHQDLPLGLMDDIYEFSKNFSLRIDELEEMLTNNRIWRNRTVDIGVVTAEDALNYGFSGVMLRGSGIQWDLRKTQPYDVYDQVEFDVPIGSRGDCYDRYLCRVEEMRQSIRIISQCLNKMPPGEIKVDDAKVSPPKRAEMKTSMESLIHHFKLYTEGYQVPPGATYTAIEAPKGEFGVYLVSDGSSRPYRCKIKAPGFAHLAGLDKMSKGHMLADVVAIIGTQDIVFGEVDR

Entity 5 Entity 5 polymer

Description description	NADH:ubiquinone oxidoreductase core subunit S3
Molecular weight formula_weight	30384.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	5

PVKMAAAAARGCWQRLVGSAAPARVAGRPSVLLLPVRRESASADTRPTVRPRNDVAHKQLSAFGEYVAEILPKYVQQVQVSCFSELEICIHPDGVIPVLTFLRDHSNAQFKSLADLTAVDIPTRQNRFEIVYNLLSLRFNSRIRVKTYTDELTPVESSVSVYKAANWYEREIWDMFGVFFANHPDLRRILTDYGFEGHPFRKDFPLSGYVELRYDDEVKRVVAEPVELAQEFRKFDLNSPWEAFPAYRQPPESLKLEAGDKKPEAK

Entity 6 Entity 6 polymer

Description description	Mitochondrial complex I, PSST subunit
Molecular weight formula_weight	24622.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	6

MLPLKFPGRGGAAPRLFHPILAVRSGMGAALQVRGVHSSMAADSPSSTQPAVSQARAVVPKPAALPSSRGEYVVAKLDDLINWARRSSLWPMTFGLACCAVEMMHMAAPRYDMDRFGVVFRASPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVVSMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALLYGILQLQKKIKREKRLRIWYRR

Entity 7 Entity 7 polymer

Description description	Mitochondrial complex I, TYKY subunit
Molecular weight formula_weight	24496.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	9

MRKPKMRCLTMPVLLRALAQAQAARAGHASGRGLHSSAVAATYKYVNLREPSMDMKSVTDRAAQTLLWTELIRGLGMTLSYLFREPATINYPFEKGPLSPRFRGEHALRRYPSGEERCIACKLCEAVCPAQAITIEAEPRADGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEFSTETHEELLYNKEKLLNNGDKWEAEIAANIQADYLYR

Entity 8 Entity 8 polymer

Description description	Mitochondrial complex I, 10 kDa subunit
Molecular weight formula_weight	11916.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	a

MAASLLLRQGRPGTLKTVLLEAGVFRGLAPAVSLSAESGKNEKGLPPNPKKQSPPKKPASAAPTEPFDNTTYKNLQHHDYSTYTFLDLNLDLSKFRMPQPSSGRESPRH

Entity 9 Entity 9 polymer

Description description	Mitochondrial complex I, 13 kDa subunit
Molecular weight formula_weight	13457.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	b

MAAAVTFLRLLGRGGAVTRGLPGGARCFGVRTSPTGEKVTHTGQVYDDEDYRRVRFVGRQKEVNENFAIDLIAEQPVSQVGSRVISCDGGGGALGHPRVYINLDKETKTGTCGYCGLQFRQQHH

Entity 10 Entity 10 polymer

Description description	NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial
Molecular weight formula_weight	19382.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	c

MSVALRQALWGRRVGTVAAVSVSKVSTRSLSTSTWRLAQDQTRDTQLITVDEKLDITTLTGVPEEHIKTRKARIFVPARNNMQSGVNNTKKWKMEFDTRERWENPLMGWASTADPLSNLVLTFSTKEDAIAFAEKNGWSYDVEERKVPKPKSKSYGANFSWNKRTRVSTK

Entity 11 Entity 11 polymer

Description description	NADH:ubiquinone oxidoreductase subunit A9
Molecular weight formula_weight	43025.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	d

MAAAVHLRVVRVLPMSRSSVPALAASVFHSPPQRQLHHAVIPHGKGGRSSVSGIVATVFGATGFLGRYLVNHLGRMGSQVIVPYRCEPYDTMHLRPMGDLGQIIFMDWNGRDKDSIRRAVEHSNVVINLVGREWETKNFDFEDVFVKIPQAIAQVSKEAGVEKFIHISHLNADIKSSSKYLRNKAVGEKEVRETFPEATIIKPADIFGREDRFLNYFANIRWFGGVPLISLGKKTVKQPVYIVDVTKGIINAIKDPDARGKTFAFVGPNRYLLFDLVQYVFAVAHRPFLPYPMPHFAYRWIGRLFEISPFEPWTTRDKVERIHTTDRTLPHLPGLEDLGVQATPLELKAIEVLRRHRTYRWLSSEIEDVQPAKTVPASGP

Entity 12 Entity 12 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2
Molecular weight formula_weight	11097.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	e

MAAAAAIRGVRGKLGLREIRIHLCQRSPGSQGVRDFIEKRYVELKKANPDLPILIRECSDVQPKLWARYAFGQEKNVSLNNFSADQVTRALENVLSSKA

Entity 13 Entity 13 polymer

Description description	Mitochondrial complex I, B13 subunit
Molecular weight formula_weight	13287.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	f

MAGLLKKTTGLVGLAVCETPHERLKILYTKILDVLGHIPKNAAYRKYTEQITNEKLSIVKAEPDVKKLEEQLQGGQIEEVILQAENELSLARKMIQWKPWEPLVEEPPASQWKWPI

Entity 14 Entity 14 polymer

Description description	NADH:ubiquinone oxidoreductase subunit A6
Molecular weight formula_weight	16302.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	g

NGVELGSDFLSKMAASGLRQAAVAASTSVKPIFSRDMNEAKRRVRELYRAWYREVPNTVHLFQLDISVKQGRDKVREMFKKNAHVTDPRVVDLLVIKGKMELEETINVWKQRTHVMRFFHETEAPRPKDFLSKFYVGHDP

Entity 15 Entity 15 polymer

Description description	Mitochondrial complex I, B14.5a subunit
Molecular weight formula_weight	12701.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	h

KMASATRLIQGLRNWASGRDLQAKLQLRYQEISKRTQPPPKLPVGPSHRLSNNYYCARDGRREAMPPSIVMSSQKVLVAGKPAESSAVAASEKKAVSPAPPIKRWELSQDEPYL

Entity 16 Entity 16 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12
Molecular weight formula_weight	17115.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	i

MELLQVLKRGLQQVSGHGGLRGYLRVLFRANDVRVGTLVGEDKYGNKYYEDNKQFFGRHRWVIYTTEMNGKNTFWDVDGSMVPPEWHRWLHCMTDDPPTVKPPTARKFIWTNHKFNLSGTPQQYVPYSTTRKKIQEWVPPSTPYK

Entity 17 Entity 17 polymer

Description description	Acyl carrier protein
Molecular weight formula_weight	17608.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	j

VEVKDFYTTNYQTAVSFSPLGPMPSMALMAVSLSGANVPKSGGRPEESRVPVLTQRKVPGRVTPLCRQYSDAPPLTLEGIKDRVLYVLKLYDKIDPEKLSVNSHFMKDLGLDSLDQVEIIMAMEDEFGFEIPDIDAEKLMCPQEIVDYIADKKDVYE

Entity 18 Entity 18 polymer

Description description	Mitochondrial complex I, B16.6 subunit
Molecular weight formula_weight	16766.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	q

MAASKVKQDMPPVGGYGPIDYKRNLPRRGLSGYSMFAVGIGALLFGYWSMMRWNRERRRLQIEDFEARIALMPLLQAEKDRRVLQMLRENLEEEATIMKDVPGWKVGESVFHTTRWVTPMMGELYGLRTGEEILSSTYGFIWYT

Entity 19 Entity 19 non-polymer

Description description	IRON/SULFUR CLUSTER
Molecular weight formula_weight	351.6 kDa
Source method src_method	syn
Copy count entity_count	6

Entity 20 Entity 20 non-polymer

Description description	FLAVIN MONONUCLEOTIDE
Molecular weight formula_weight	456.3 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 21 Entity 21 non-polymer

Description description	1,4-DIHYDRONICOTINAMIDE ADENINE DINUCLEOTIDE
Molecular weight formula_weight	665.4 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 22 Entity 22 non-polymer

Description description	FE2/S2 (INORGANIC) CLUSTER
Molecular weight formula_weight	175.8 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 23 Entity 23 non-polymer

Description description	POTASSIUM ION
Molecular weight formula_weight	39.1 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 24 Entity 24 non-polymer

Description description	1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE
Molecular weight formula_weight	790.1 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 25 Entity 25 non-polymer

Description description	1,2-Distearoyl-sn-glycerophosphoethanolamine
Molecular weight formula_weight	748.1 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 26 Entity 26 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 27 Entity 27 non-polymer

Description description	NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE
Molecular weight formula_weight	745.4 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 28 Entity 28 non-polymer

Description description	S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate
Molecular weight formula_weight	568.7 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 29 Entity 29 non-polymer

Description description	CARDIOLIPIN
Molecular weight formula_weight	1464.0 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 30 Entity 30 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	1472

▼

6. Fold Classification (SCOP + CATH) 6 domains

SCOP 2.08 (6 domains)

Domain ID domain_id	d6zk911
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.142 — Nqo1 FMN-binding domain-like
Superfamily Superfamily superfamily	c.142.1 — Nqo1 FMN-binding domain-like
Family Family family	c.142.1.0 — automated matches

Domain ID domain_id	d6zk912
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.15 — beta-Grasp (ubiquitin-like)
Superfamily Superfamily superfamily	d.15.13 — Nqo1 middle domain-like
Family Family family	d.15.13.0 — automated matches

Domain ID domain_id	d6zk913
Class class	a — All alpha proteins
Fold Fold fold	a.29 — Bromodomain-like
Superfamily Superfamily superfamily	a.29.12 — Nqo1C-terminal domain-like
Family Family family	a.29.12.0 — automated matches

Domain ID domain_id	d6zk94_
Class class	e — Multi-domain proteins (alpha and beta)
Fold Fold fold	e.18 — HydB/Nqo4-like
Superfamily Superfamily superfamily	e.18.1 — HydB/Nqo4-like
Family Family family	e.18.1.0 — automated matches

Domain ID domain_id	d6zk9g_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.71 — LYR proteins from mammalian respiratory complex I
Superfamily Superfamily superfamily	f.71.1 — LYR protein-like
Family Family family	f.71.1.1 — LYR proteins

Domain ID domain_id	d6zk9j_
Class class	a — All alpha proteins
Fold Fold fold	a.28 — Acyl carrier protein-like
Superfamily Superfamily superfamily	a.28.1 — ACP-like
Family Family family	a.28.1.0 — automated matches

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	2.30 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	315484

Peripheral domain of open complex I during turnover

1. Protein Identity and Related Structures Protein Identity & Related Structures

NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Mitochondrial complex I, 24 kDa subunit

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

NADH:ubiquinone oxidoreductase core subunit S1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

NADH:ubiquinone oxidoreductase core subunit S3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

NADH:ubiquinone oxidoreductase subunit A9

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Mitochondrial complex I, B13 subunit

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

NADH:ubiquinone oxidoreductase subunit A6

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Mitochondrial complex I, B14.5a subunit

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer