6zka

Membrane domain of open complex I during turnover

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

NADH-ubiquinone oxidoreductase chain 3

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 29	NADH-ubiquinone oxidoreductase chain 1 × 1 （O78747） NADH-ubiquinone oxidoreductase chain 6 × 1 （O78757） NADH-ubiquinone oxidoreductase chain 4L × 1 （O78754） NADH-ubiquinone oxidoreductase chain 5 × 1 （O78756） NADH-ubiquinone oxidoreductase chain 4 × 1 （O78755） NADH-ubiquinone oxidoreductase chain 2 × 1 （O78748） Mitochondrial complex I, B14.7 subunit × 1 （W5PAR2） NADH:ubiquinone oxidoreductase subunit B5 × 1 （W5QHN8） Acyl carrier protein × 1 （W5NQT7） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （W5PYA5） Mitochondrial complex I, PDSW subunit × 1 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （W5QBF5） NADH:ubiquinone oxidoreductase subunit S5 × 1 （W5QFF9） NADH:ubiquinone oxidoreductase subunit A3 × 1 （W5NYM7） NADH:ubiquinone oxidoreductase subunit B3 × 1 （W5Q5T4） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （W5P9Q8） NADH:ubiquinone oxidoreductase subunit B4 × 1 （W5QF73） Mitochondrial complex I, B16.6 subunit × 1 Mitochondrial complex I, B17 subunit × 1 （W5PZE3） NADH:ubiquinone oxidoreductase subunit B7 × 1 （W5P5V3） NADH:ubiquinone oxidoreductase subunit B9 × 1 （W5PGA3） NADH:ubiquinone oxidoreductase subunit B2 × 1 （W5PVD7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （W5Q1B0） Mitochondrial complex I, ESSS subunit × 1 （W5PWF1） Mitochondrial complex I, KFYI subunit × 1 Mitochondrial complex I, MNLL subunit × 1 Mitochondrial complex I, MWFE subunit × 1 Mitochondrial complex I, ND4L subunit × 1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 5 2-decyl-5,6-dimethoxy-3-methylcyclohexa-2,5-diene-1,4-dione × 1 1,2-Distearoyl-sn-glycerophosphoethanolamine × 12 CARDIOLIPIN × 7 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1 ADENOSINE MONOPHOSPHATE × 1 MYRISTIC ACID × 1 water × 29	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NU3M_SHEEP
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–115； UniProt 1–115

NADH-ubiquinone oxidoreductase chain 1

OrganismNot specified

UniProt O78747

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 29	NADH-ubiquinone oxidoreductase chain 3 × 1 （O78753） NADH-ubiquinone oxidoreductase chain 6 × 1 （O78757） NADH-ubiquinone oxidoreductase chain 4L × 1 （O78754） NADH-ubiquinone oxidoreductase chain 5 × 1 （O78756） NADH-ubiquinone oxidoreductase chain 4 × 1 （O78755） NADH-ubiquinone oxidoreductase chain 2 × 1 （O78748） Mitochondrial complex I, B14.7 subunit × 1 （W5PAR2） NADH:ubiquinone oxidoreductase subunit B5 × 1 （W5QHN8） Acyl carrier protein × 1 （W5NQT7） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （W5PYA5） Mitochondrial complex I, PDSW subunit × 1 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （W5QBF5） NADH:ubiquinone oxidoreductase subunit S5 × 1 （W5QFF9） NADH:ubiquinone oxidoreductase subunit A3 × 1 （W5NYM7） NADH:ubiquinone oxidoreductase subunit B3 × 1 （W5Q5T4） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （W5P9Q8） NADH:ubiquinone oxidoreductase subunit B4 × 1 （W5QF73） Mitochondrial complex I, B16.6 subunit × 1 Mitochondrial complex I, B17 subunit × 1 （W5PZE3） NADH:ubiquinone oxidoreductase subunit B7 × 1 （W5P5V3） NADH:ubiquinone oxidoreductase subunit B9 × 1 （W5PGA3） NADH:ubiquinone oxidoreductase subunit B2 × 1 （W5PVD7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （W5Q1B0） Mitochondrial complex I, ESSS subunit × 1 （W5PWF1） Mitochondrial complex I, KFYI subunit × 1 Mitochondrial complex I, MNLL subunit × 1 Mitochondrial complex I, MWFE subunit × 1 Mitochondrial complex I, ND4L subunit × 1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 5 2-decyl-5,6-dimethoxy-3-methylcyclohexa-2,5-diene-1,4-dione × 1 1,2-Distearoyl-sn-glycerophosphoethanolamine × 12 CARDIOLIPIN × 7 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1 ADENOSINE MONOPHOSPHATE × 1 MYRISTIC ACID × 1 water × 29	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NU1M_SHEEP
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain H； PDBConstruct 1–318； UniProt 1–318

NADH-ubiquinone oxidoreductase chain 6

OrganismNot specified

UniProt O78757

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 29	NADH-ubiquinone oxidoreductase chain 3 × 1 （O78753） NADH-ubiquinone oxidoreductase chain 1 × 1 （O78747） NADH-ubiquinone oxidoreductase chain 4L × 1 （O78754） NADH-ubiquinone oxidoreductase chain 5 × 1 （O78756） NADH-ubiquinone oxidoreductase chain 4 × 1 （O78755） NADH-ubiquinone oxidoreductase chain 2 × 1 （O78748） Mitochondrial complex I, B14.7 subunit × 1 （W5PAR2） NADH:ubiquinone oxidoreductase subunit B5 × 1 （W5QHN8） Acyl carrier protein × 1 （W5NQT7） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （W5PYA5） Mitochondrial complex I, PDSW subunit × 1 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （W5QBF5） NADH:ubiquinone oxidoreductase subunit S5 × 1 （W5QFF9） NADH:ubiquinone oxidoreductase subunit A3 × 1 （W5NYM7） NADH:ubiquinone oxidoreductase subunit B3 × 1 （W5Q5T4） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （W5P9Q8） NADH:ubiquinone oxidoreductase subunit B4 × 1 （W5QF73） Mitochondrial complex I, B16.6 subunit × 1 Mitochondrial complex I, B17 subunit × 1 （W5PZE3） NADH:ubiquinone oxidoreductase subunit B7 × 1 （W5P5V3） NADH:ubiquinone oxidoreductase subunit B9 × 1 （W5PGA3） NADH:ubiquinone oxidoreductase subunit B2 × 1 （W5PVD7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （W5Q1B0） Mitochondrial complex I, ESSS subunit × 1 （W5PWF1） Mitochondrial complex I, KFYI subunit × 1 Mitochondrial complex I, MNLL subunit × 1 Mitochondrial complex I, MWFE subunit × 1 Mitochondrial complex I, ND4L subunit × 1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 5 2-decyl-5,6-dimethoxy-3-methylcyclohexa-2,5-diene-1,4-dione × 1 1,2-Distearoyl-sn-glycerophosphoethanolamine × 12 CARDIOLIPIN × 7 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1 ADENOSINE MONOPHOSPHATE × 1 MYRISTIC ACID × 1 water × 29	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NU6M_SHEEP
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain J； PDBConstruct 1–175； UniProt 1–175

NADH-ubiquinone oxidoreductase chain 4L

OrganismNot specified

UniProt O78754

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 29	NADH-ubiquinone oxidoreductase chain 3 × 1 （O78753） NADH-ubiquinone oxidoreductase chain 1 × 1 （O78747） NADH-ubiquinone oxidoreductase chain 6 × 1 （O78757） NADH-ubiquinone oxidoreductase chain 5 × 1 （O78756） NADH-ubiquinone oxidoreductase chain 4 × 1 （O78755） NADH-ubiquinone oxidoreductase chain 2 × 1 （O78748） Mitochondrial complex I, B14.7 subunit × 1 （W5PAR2） NADH:ubiquinone oxidoreductase subunit B5 × 1 （W5QHN8） Acyl carrier protein × 1 （W5NQT7） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （W5PYA5） Mitochondrial complex I, PDSW subunit × 1 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （W5QBF5） NADH:ubiquinone oxidoreductase subunit S5 × 1 （W5QFF9） NADH:ubiquinone oxidoreductase subunit A3 × 1 （W5NYM7） NADH:ubiquinone oxidoreductase subunit B3 × 1 （W5Q5T4） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （W5P9Q8） NADH:ubiquinone oxidoreductase subunit B4 × 1 （W5QF73） Mitochondrial complex I, B16.6 subunit × 1 Mitochondrial complex I, B17 subunit × 1 （W5PZE3） NADH:ubiquinone oxidoreductase subunit B7 × 1 （W5P5V3） NADH:ubiquinone oxidoreductase subunit B9 × 1 （W5PGA3） NADH:ubiquinone oxidoreductase subunit B2 × 1 （W5PVD7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （W5Q1B0） Mitochondrial complex I, ESSS subunit × 1 （W5PWF1） Mitochondrial complex I, KFYI subunit × 1 Mitochondrial complex I, MNLL subunit × 1 Mitochondrial complex I, MWFE subunit × 1 Mitochondrial complex I, ND4L subunit × 1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 5 2-decyl-5,6-dimethoxy-3-methylcyclohexa-2,5-diene-1,4-dione × 1 1,2-Distearoyl-sn-glycerophosphoethanolamine × 12 CARDIOLIPIN × 7 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1 ADENOSINE MONOPHOSPHATE × 1 MYRISTIC ACID × 1 water × 29	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NU4LM_SHEEP
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain K； PDBConstruct 1–98； UniProt 1–98

NADH-ubiquinone oxidoreductase chain 5

OrganismNot specified

UniProt O78756

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 29	NADH-ubiquinone oxidoreductase chain 3 × 1 （O78753） NADH-ubiquinone oxidoreductase chain 1 × 1 （O78747） NADH-ubiquinone oxidoreductase chain 6 × 1 （O78757） NADH-ubiquinone oxidoreductase chain 4L × 1 （O78754） NADH-ubiquinone oxidoreductase chain 4 × 1 （O78755） NADH-ubiquinone oxidoreductase chain 2 × 1 （O78748） Mitochondrial complex I, B14.7 subunit × 1 （W5PAR2） NADH:ubiquinone oxidoreductase subunit B5 × 1 （W5QHN8） Acyl carrier protein × 1 （W5NQT7） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （W5PYA5） Mitochondrial complex I, PDSW subunit × 1 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （W5QBF5） NADH:ubiquinone oxidoreductase subunit S5 × 1 （W5QFF9） NADH:ubiquinone oxidoreductase subunit A3 × 1 （W5NYM7） NADH:ubiquinone oxidoreductase subunit B3 × 1 （W5Q5T4） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （W5P9Q8） NADH:ubiquinone oxidoreductase subunit B4 × 1 （W5QF73） Mitochondrial complex I, B16.6 subunit × 1 Mitochondrial complex I, B17 subunit × 1 （W5PZE3） NADH:ubiquinone oxidoreductase subunit B7 × 1 （W5P5V3） NADH:ubiquinone oxidoreductase subunit B9 × 1 （W5PGA3） NADH:ubiquinone oxidoreductase subunit B2 × 1 （W5PVD7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （W5Q1B0） Mitochondrial complex I, ESSS subunit × 1 （W5PWF1） Mitochondrial complex I, KFYI subunit × 1 Mitochondrial complex I, MNLL subunit × 1 Mitochondrial complex I, MWFE subunit × 1 Mitochondrial complex I, ND4L subunit × 1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 5 2-decyl-5,6-dimethoxy-3-methylcyclohexa-2,5-diene-1,4-dione × 1 1,2-Distearoyl-sn-glycerophosphoethanolamine × 12 CARDIOLIPIN × 7 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1 ADENOSINE MONOPHOSPHATE × 1 MYRISTIC ACID × 1 water × 29	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NU5M_SHEEP
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain L； PDBConstruct 1–606； UniProt 1–606

NADH-ubiquinone oxidoreductase chain 4

OrganismNot specified

UniProt O78755

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 29	NADH-ubiquinone oxidoreductase chain 3 × 1 （O78753） NADH-ubiquinone oxidoreductase chain 1 × 1 （O78747） NADH-ubiquinone oxidoreductase chain 6 × 1 （O78757） NADH-ubiquinone oxidoreductase chain 4L × 1 （O78754） NADH-ubiquinone oxidoreductase chain 5 × 1 （O78756） NADH-ubiquinone oxidoreductase chain 2 × 1 （O78748） Mitochondrial complex I, B14.7 subunit × 1 （W5PAR2） NADH:ubiquinone oxidoreductase subunit B5 × 1 （W5QHN8） Acyl carrier protein × 1 （W5NQT7） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （W5PYA5） Mitochondrial complex I, PDSW subunit × 1 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （W5QBF5） NADH:ubiquinone oxidoreductase subunit S5 × 1 （W5QFF9） NADH:ubiquinone oxidoreductase subunit A3 × 1 （W5NYM7） NADH:ubiquinone oxidoreductase subunit B3 × 1 （W5Q5T4） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （W5P9Q8） NADH:ubiquinone oxidoreductase subunit B4 × 1 （W5QF73） Mitochondrial complex I, B16.6 subunit × 1 Mitochondrial complex I, B17 subunit × 1 （W5PZE3） NADH:ubiquinone oxidoreductase subunit B7 × 1 （W5P5V3） NADH:ubiquinone oxidoreductase subunit B9 × 1 （W5PGA3） NADH:ubiquinone oxidoreductase subunit B2 × 1 （W5PVD7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （W5Q1B0） Mitochondrial complex I, ESSS subunit × 1 （W5PWF1） Mitochondrial complex I, KFYI subunit × 1 Mitochondrial complex I, MNLL subunit × 1 Mitochondrial complex I, MWFE subunit × 1 Mitochondrial complex I, ND4L subunit × 1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 5 2-decyl-5,6-dimethoxy-3-methylcyclohexa-2,5-diene-1,4-dione × 1 1,2-Distearoyl-sn-glycerophosphoethanolamine × 12 CARDIOLIPIN × 7 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1 ADENOSINE MONOPHOSPHATE × 1 MYRISTIC ACID × 1 water × 29	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NU4M_SHEEP
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain M； PDBConstruct 1–459； UniProt 1–459

NADH-ubiquinone oxidoreductase chain 2

OrganismNot specified

UniProt O78748

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 29	NADH-ubiquinone oxidoreductase chain 3 × 1 （O78753） NADH-ubiquinone oxidoreductase chain 1 × 1 （O78747） NADH-ubiquinone oxidoreductase chain 6 × 1 （O78757） NADH-ubiquinone oxidoreductase chain 4L × 1 （O78754） NADH-ubiquinone oxidoreductase chain 5 × 1 （O78756） NADH-ubiquinone oxidoreductase chain 4 × 1 （O78755） Mitochondrial complex I, B14.7 subunit × 1 （W5PAR2） NADH:ubiquinone oxidoreductase subunit B5 × 1 （W5QHN8） Acyl carrier protein × 1 （W5NQT7） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （W5PYA5） Mitochondrial complex I, PDSW subunit × 1 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （W5QBF5） NADH:ubiquinone oxidoreductase subunit S5 × 1 （W5QFF9） NADH:ubiquinone oxidoreductase subunit A3 × 1 （W5NYM7） NADH:ubiquinone oxidoreductase subunit B3 × 1 （W5Q5T4） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （W5P9Q8） NADH:ubiquinone oxidoreductase subunit B4 × 1 （W5QF73） Mitochondrial complex I, B16.6 subunit × 1 Mitochondrial complex I, B17 subunit × 1 （W5PZE3） NADH:ubiquinone oxidoreductase subunit B7 × 1 （W5P5V3） NADH:ubiquinone oxidoreductase subunit B9 × 1 （W5PGA3） NADH:ubiquinone oxidoreductase subunit B2 × 1 （W5PVD7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （W5Q1B0） Mitochondrial complex I, ESSS subunit × 1 （W5PWF1） Mitochondrial complex I, KFYI subunit × 1 Mitochondrial complex I, MNLL subunit × 1 Mitochondrial complex I, MWFE subunit × 1 Mitochondrial complex I, ND4L subunit × 1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 5 2-decyl-5,6-dimethoxy-3-methylcyclohexa-2,5-diene-1,4-dione × 1 1,2-Distearoyl-sn-glycerophosphoethanolamine × 12 CARDIOLIPIN × 7 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1 ADENOSINE MONOPHOSPHATE × 1 MYRISTIC ACID × 1 water × 29	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NU2M_SHEEP
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain N； PDBConstruct 1–347； UniProt 1–347

Mitochondrial complex I, B14.7 subunit

OrganismNot specified

UniProt W5PAR2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 29	NADH-ubiquinone oxidoreductase chain 3 × 1 （O78753） NADH-ubiquinone oxidoreductase chain 1 × 1 （O78747） NADH-ubiquinone oxidoreductase chain 6 × 1 （O78757） NADH-ubiquinone oxidoreductase chain 4L × 1 （O78754） NADH-ubiquinone oxidoreductase chain 5 × 1 （O78756） NADH-ubiquinone oxidoreductase chain 4 × 1 （O78755） NADH-ubiquinone oxidoreductase chain 2 × 1 （O78748） NADH:ubiquinone oxidoreductase subunit B5 × 1 （W5QHN8） Acyl carrier protein × 1 （W5NQT7） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （W5PYA5） Mitochondrial complex I, PDSW subunit × 1 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （W5QBF5） NADH:ubiquinone oxidoreductase subunit S5 × 1 （W5QFF9） NADH:ubiquinone oxidoreductase subunit A3 × 1 （W5NYM7） NADH:ubiquinone oxidoreductase subunit B3 × 1 （W5Q5T4） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （W5P9Q8） NADH:ubiquinone oxidoreductase subunit B4 × 1 （W5QF73） Mitochondrial complex I, B16.6 subunit × 1 Mitochondrial complex I, B17 subunit × 1 （W5PZE3） NADH:ubiquinone oxidoreductase subunit B7 × 1 （W5P5V3） NADH:ubiquinone oxidoreductase subunit B9 × 1 （W5PGA3） NADH:ubiquinone oxidoreductase subunit B2 × 1 （W5PVD7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （W5Q1B0） Mitochondrial complex I, ESSS subunit × 1 （W5PWF1） Mitochondrial complex I, KFYI subunit × 1 Mitochondrial complex I, MNLL subunit × 1 Mitochondrial complex I, MWFE subunit × 1 Mitochondrial complex I, ND4L subunit × 1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 5 2-decyl-5,6-dimethoxy-3-methylcyclohexa-2,5-diene-1,4-dione × 1 1,2-Distearoyl-sn-glycerophosphoethanolamine × 12 CARDIOLIPIN × 7 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1 ADENOSINE MONOPHOSPHATE × 1 MYRISTIC ACID × 1 water × 29	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	W5PAR2_SHEEP
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain V； PDBConstruct 1–141； UniProt 1–141

NADH:ubiquinone oxidoreductase subunit B5

OrganismNot specified

UniProt W5QHN8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 29	NADH-ubiquinone oxidoreductase chain 3 × 1 （O78753） NADH-ubiquinone oxidoreductase chain 1 × 1 （O78747） NADH-ubiquinone oxidoreductase chain 6 × 1 （O78757） NADH-ubiquinone oxidoreductase chain 4L × 1 （O78754） NADH-ubiquinone oxidoreductase chain 5 × 1 （O78756） NADH-ubiquinone oxidoreductase chain 4 × 1 （O78755） NADH-ubiquinone oxidoreductase chain 2 × 1 （O78748） Mitochondrial complex I, B14.7 subunit × 1 （W5PAR2） Acyl carrier protein × 1 （W5NQT7） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （W5PYA5） Mitochondrial complex I, PDSW subunit × 1 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （W5QBF5） NADH:ubiquinone oxidoreductase subunit S5 × 1 （W5QFF9） NADH:ubiquinone oxidoreductase subunit A3 × 1 （W5NYM7） NADH:ubiquinone oxidoreductase subunit B3 × 1 （W5Q5T4） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （W5P9Q8） NADH:ubiquinone oxidoreductase subunit B4 × 1 （W5QF73） Mitochondrial complex I, B16.6 subunit × 1 Mitochondrial complex I, B17 subunit × 1 （W5PZE3） NADH:ubiquinone oxidoreductase subunit B7 × 1 （W5P5V3） NADH:ubiquinone oxidoreductase subunit B9 × 1 （W5PGA3） NADH:ubiquinone oxidoreductase subunit B2 × 1 （W5PVD7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （W5Q1B0） Mitochondrial complex I, ESSS subunit × 1 （W5PWF1） Mitochondrial complex I, KFYI subunit × 1 Mitochondrial complex I, MNLL subunit × 1 Mitochondrial complex I, MWFE subunit × 1 Mitochondrial complex I, ND4L subunit × 1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 5 2-decyl-5,6-dimethoxy-3-methylcyclohexa-2,5-diene-1,4-dione × 1 1,2-Distearoyl-sn-glycerophosphoethanolamine × 12 CARDIOLIPIN × 7 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1 ADENOSINE MONOPHOSPHATE × 1 MYRISTIC ACID × 1 water × 29	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	W5QHN8_SHEEP
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain W； PDBConstruct 1–189； UniProt 1–189

Acyl carrier protein

OrganismNot specified

UniProt W5NQT7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 29	NADH-ubiquinone oxidoreductase chain 3 × 1 （O78753） NADH-ubiquinone oxidoreductase chain 1 × 1 （O78747） NADH-ubiquinone oxidoreductase chain 6 × 1 （O78757） NADH-ubiquinone oxidoreductase chain 4L × 1 （O78754） NADH-ubiquinone oxidoreductase chain 5 × 1 （O78756） NADH-ubiquinone oxidoreductase chain 4 × 1 （O78755） NADH-ubiquinone oxidoreductase chain 2 × 1 （O78748） Mitochondrial complex I, B14.7 subunit × 1 （W5PAR2） NADH:ubiquinone oxidoreductase subunit B5 × 1 （W5QHN8） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （W5PYA5） Mitochondrial complex I, PDSW subunit × 1 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （W5QBF5） NADH:ubiquinone oxidoreductase subunit S5 × 1 （W5QFF9） NADH:ubiquinone oxidoreductase subunit A3 × 1 （W5NYM7） NADH:ubiquinone oxidoreductase subunit B3 × 1 （W5Q5T4） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （W5P9Q8） NADH:ubiquinone oxidoreductase subunit B4 × 1 （W5QF73） Mitochondrial complex I, B16.6 subunit × 1 Mitochondrial complex I, B17 subunit × 1 （W5PZE3） NADH:ubiquinone oxidoreductase subunit B7 × 1 （W5P5V3） NADH:ubiquinone oxidoreductase subunit B9 × 1 （W5PGA3） NADH:ubiquinone oxidoreductase subunit B2 × 1 （W5PVD7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （W5Q1B0） Mitochondrial complex I, ESSS subunit × 1 （W5PWF1） Mitochondrial complex I, KFYI subunit × 1 Mitochondrial complex I, MNLL subunit × 1 Mitochondrial complex I, MWFE subunit × 1 Mitochondrial complex I, ND4L subunit × 1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 5 2-decyl-5,6-dimethoxy-3-methylcyclohexa-2,5-diene-1,4-dione × 1 1,2-Distearoyl-sn-glycerophosphoethanolamine × 12 CARDIOLIPIN × 7 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1 ADENOSINE MONOPHOSPHATE × 1 MYRISTIC ACID × 1 water × 29	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	W5NQT7_SHEEP
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain X； PDBConstruct 1–157； UniProt 1–157

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8

OrganismNot specified

UniProt W5PYA5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 29	NADH-ubiquinone oxidoreductase chain 3 × 1 （O78753） NADH-ubiquinone oxidoreductase chain 1 × 1 （O78747） NADH-ubiquinone oxidoreductase chain 6 × 1 （O78757） NADH-ubiquinone oxidoreductase chain 4L × 1 （O78754） NADH-ubiquinone oxidoreductase chain 5 × 1 （O78756） NADH-ubiquinone oxidoreductase chain 4 × 1 （O78755） NADH-ubiquinone oxidoreductase chain 2 × 1 （O78748） Mitochondrial complex I, B14.7 subunit × 1 （W5PAR2） NADH:ubiquinone oxidoreductase subunit B5 × 1 （W5QHN8） Acyl carrier protein × 1 （W5NQT7） Mitochondrial complex I, PDSW subunit × 1 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （W5QBF5） NADH:ubiquinone oxidoreductase subunit S5 × 1 （W5QFF9） NADH:ubiquinone oxidoreductase subunit A3 × 1 （W5NYM7） NADH:ubiquinone oxidoreductase subunit B3 × 1 （W5Q5T4） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （W5P9Q8） NADH:ubiquinone oxidoreductase subunit B4 × 1 （W5QF73） Mitochondrial complex I, B16.6 subunit × 1 Mitochondrial complex I, B17 subunit × 1 （W5PZE3） NADH:ubiquinone oxidoreductase subunit B7 × 1 （W5P5V3） NADH:ubiquinone oxidoreductase subunit B9 × 1 （W5PGA3） NADH:ubiquinone oxidoreductase subunit B2 × 1 （W5PVD7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （W5Q1B0） Mitochondrial complex I, ESSS subunit × 1 （W5PWF1） Mitochondrial complex I, KFYI subunit × 1 Mitochondrial complex I, MNLL subunit × 1 Mitochondrial complex I, MWFE subunit × 1 Mitochondrial complex I, ND4L subunit × 1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 5 2-decyl-5,6-dimethoxy-3-methylcyclohexa-2,5-diene-1,4-dione × 1 1,2-Distearoyl-sn-glycerophosphoethanolamine × 12 CARDIOLIPIN × 7 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1 ADENOSINE MONOPHOSPHATE × 1 MYRISTIC ACID × 1 water × 29	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	W5PYA5_SHEEP
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain Y； PDBConstruct 1–172； UniProt 1–172

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial

OrganismNot specified

UniProt W5QBF5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 29	NADH-ubiquinone oxidoreductase chain 3 × 1 （O78753） NADH-ubiquinone oxidoreductase chain 1 × 1 （O78747） NADH-ubiquinone oxidoreductase chain 6 × 1 （O78757） NADH-ubiquinone oxidoreductase chain 4L × 1 （O78754） NADH-ubiquinone oxidoreductase chain 5 × 1 （O78756） NADH-ubiquinone oxidoreductase chain 4 × 1 （O78755） NADH-ubiquinone oxidoreductase chain 2 × 1 （O78748） Mitochondrial complex I, B14.7 subunit × 1 （W5PAR2） NADH:ubiquinone oxidoreductase subunit B5 × 1 （W5QHN8） Acyl carrier protein × 1 （W5NQT7） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （W5PYA5） Mitochondrial complex I, PDSW subunit × 1 NADH:ubiquinone oxidoreductase subunit S5 × 1 （W5QFF9） NADH:ubiquinone oxidoreductase subunit A3 × 1 （W5NYM7） NADH:ubiquinone oxidoreductase subunit B3 × 1 （W5Q5T4） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （W5P9Q8） NADH:ubiquinone oxidoreductase subunit B4 × 1 （W5QF73） Mitochondrial complex I, B16.6 subunit × 1 Mitochondrial complex I, B17 subunit × 1 （W5PZE3） NADH:ubiquinone oxidoreductase subunit B7 × 1 （W5P5V3） NADH:ubiquinone oxidoreductase subunit B9 × 1 （W5PGA3） NADH:ubiquinone oxidoreductase subunit B2 × 1 （W5PVD7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （W5Q1B0） Mitochondrial complex I, ESSS subunit × 1 （W5PWF1） Mitochondrial complex I, KFYI subunit × 1 Mitochondrial complex I, MNLL subunit × 1 Mitochondrial complex I, MWFE subunit × 1 Mitochondrial complex I, ND4L subunit × 1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 5 2-decyl-5,6-dimethoxy-3-methylcyclohexa-2,5-diene-1,4-dione × 1 1,2-Distearoyl-sn-glycerophosphoethanolamine × 12 CARDIOLIPIN × 7 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1 ADENOSINE MONOPHOSPHATE × 1 MYRISTIC ACID × 1 water × 29	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	W5QBF5_SHEEP
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain k； PDBConstruct 1–355； UniProt 1–355

NADH:ubiquinone oxidoreductase subunit S5

OrganismNot specified

UniProt W5QFF9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 29	NADH-ubiquinone oxidoreductase chain 3 × 1 （O78753） NADH-ubiquinone oxidoreductase chain 1 × 1 （O78747） NADH-ubiquinone oxidoreductase chain 6 × 1 （O78757） NADH-ubiquinone oxidoreductase chain 4L × 1 （O78754） NADH-ubiquinone oxidoreductase chain 5 × 1 （O78756） NADH-ubiquinone oxidoreductase chain 4 × 1 （O78755） NADH-ubiquinone oxidoreductase chain 2 × 1 （O78748） Mitochondrial complex I, B14.7 subunit × 1 （W5PAR2） NADH:ubiquinone oxidoreductase subunit B5 × 1 （W5QHN8） Acyl carrier protein × 1 （W5NQT7） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （W5PYA5） Mitochondrial complex I, PDSW subunit × 1 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （W5QBF5） NADH:ubiquinone oxidoreductase subunit A3 × 1 （W5NYM7） NADH:ubiquinone oxidoreductase subunit B3 × 1 （W5Q5T4） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （W5P9Q8） NADH:ubiquinone oxidoreductase subunit B4 × 1 （W5QF73） Mitochondrial complex I, B16.6 subunit × 1 Mitochondrial complex I, B17 subunit × 1 （W5PZE3） NADH:ubiquinone oxidoreductase subunit B7 × 1 （W5P5V3） NADH:ubiquinone oxidoreductase subunit B9 × 1 （W5PGA3） NADH:ubiquinone oxidoreductase subunit B2 × 1 （W5PVD7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （W5Q1B0） Mitochondrial complex I, ESSS subunit × 1 （W5PWF1） Mitochondrial complex I, KFYI subunit × 1 Mitochondrial complex I, MNLL subunit × 1 Mitochondrial complex I, MWFE subunit × 1 Mitochondrial complex I, ND4L subunit × 1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 5 2-decyl-5,6-dimethoxy-3-methylcyclohexa-2,5-diene-1,4-dione × 1 1,2-Distearoyl-sn-glycerophosphoethanolamine × 12 CARDIOLIPIN × 7 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1 ADENOSINE MONOPHOSPHATE × 1 MYRISTIC ACID × 1 water × 29	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	W5QFF9_SHEEP
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain l； PDBConstruct 1–106； UniProt 1–106

NADH:ubiquinone oxidoreductase subunit A3

OrganismNot specified

UniProt W5NYM7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 29	NADH-ubiquinone oxidoreductase chain 3 × 1 （O78753） NADH-ubiquinone oxidoreductase chain 1 × 1 （O78747） NADH-ubiquinone oxidoreductase chain 6 × 1 （O78757） NADH-ubiquinone oxidoreductase chain 4L × 1 （O78754） NADH-ubiquinone oxidoreductase chain 5 × 1 （O78756） NADH-ubiquinone oxidoreductase chain 4 × 1 （O78755） NADH-ubiquinone oxidoreductase chain 2 × 1 （O78748） Mitochondrial complex I, B14.7 subunit × 1 （W5PAR2） NADH:ubiquinone oxidoreductase subunit B5 × 1 （W5QHN8） Acyl carrier protein × 1 （W5NQT7） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （W5PYA5） Mitochondrial complex I, PDSW subunit × 1 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （W5QBF5） NADH:ubiquinone oxidoreductase subunit S5 × 1 （W5QFF9） NADH:ubiquinone oxidoreductase subunit B3 × 1 （W5Q5T4） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （W5P9Q8） NADH:ubiquinone oxidoreductase subunit B4 × 1 （W5QF73） Mitochondrial complex I, B16.6 subunit × 1 Mitochondrial complex I, B17 subunit × 1 （W5PZE3） NADH:ubiquinone oxidoreductase subunit B7 × 1 （W5P5V3） NADH:ubiquinone oxidoreductase subunit B9 × 1 （W5PGA3） NADH:ubiquinone oxidoreductase subunit B2 × 1 （W5PVD7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （W5Q1B0） Mitochondrial complex I, ESSS subunit × 1 （W5PWF1） Mitochondrial complex I, KFYI subunit × 1 Mitochondrial complex I, MNLL subunit × 1 Mitochondrial complex I, MWFE subunit × 1 Mitochondrial complex I, ND4L subunit × 1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 5 2-decyl-5,6-dimethoxy-3-methylcyclohexa-2,5-diene-1,4-dione × 1 1,2-Distearoyl-sn-glycerophosphoethanolamine × 12 CARDIOLIPIN × 7 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1 ADENOSINE MONOPHOSPHATE × 1 MYRISTIC ACID × 1 water × 29	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	W5NYM7_SHEEP
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain m； PDBConstruct 1–84； UniProt 1–84

NADH:ubiquinone oxidoreductase subunit B3

OrganismNot specified

UniProt W5Q5T4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 29	NADH-ubiquinone oxidoreductase chain 3 × 1 （O78753） NADH-ubiquinone oxidoreductase chain 1 × 1 （O78747） NADH-ubiquinone oxidoreductase chain 6 × 1 （O78757） NADH-ubiquinone oxidoreductase chain 4L × 1 （O78754） NADH-ubiquinone oxidoreductase chain 5 × 1 （O78756） NADH-ubiquinone oxidoreductase chain 4 × 1 （O78755） NADH-ubiquinone oxidoreductase chain 2 × 1 （O78748） Mitochondrial complex I, B14.7 subunit × 1 （W5PAR2） NADH:ubiquinone oxidoreductase subunit B5 × 1 （W5QHN8） Acyl carrier protein × 1 （W5NQT7） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （W5PYA5） Mitochondrial complex I, PDSW subunit × 1 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （W5QBF5） NADH:ubiquinone oxidoreductase subunit S5 × 1 （W5QFF9） NADH:ubiquinone oxidoreductase subunit A3 × 1 （W5NYM7） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （W5P9Q8） NADH:ubiquinone oxidoreductase subunit B4 × 1 （W5QF73） Mitochondrial complex I, B16.6 subunit × 1 Mitochondrial complex I, B17 subunit × 1 （W5PZE3） NADH:ubiquinone oxidoreductase subunit B7 × 1 （W5P5V3） NADH:ubiquinone oxidoreductase subunit B9 × 1 （W5PGA3） NADH:ubiquinone oxidoreductase subunit B2 × 1 （W5PVD7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （W5Q1B0） Mitochondrial complex I, ESSS subunit × 1 （W5PWF1） Mitochondrial complex I, KFYI subunit × 1 Mitochondrial complex I, MNLL subunit × 1 Mitochondrial complex I, MWFE subunit × 1 Mitochondrial complex I, ND4L subunit × 1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 5 2-decyl-5,6-dimethoxy-3-methylcyclohexa-2,5-diene-1,4-dione × 1 1,2-Distearoyl-sn-glycerophosphoethanolamine × 12 CARDIOLIPIN × 7 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1 ADENOSINE MONOPHOSPHATE × 1 MYRISTIC ACID × 1 water × 29	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	W5Q5T4_SHEEP
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain n； PDBConstruct 1–98； UniProt 1–98

NADH dehydrogenase [ubiquinone] 1 subunit C2

OrganismNot specified

UniProt W5P9Q8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 29	NADH-ubiquinone oxidoreductase chain 3 × 1 （O78753） NADH-ubiquinone oxidoreductase chain 1 × 1 （O78747） NADH-ubiquinone oxidoreductase chain 6 × 1 （O78757） NADH-ubiquinone oxidoreductase chain 4L × 1 （O78754） NADH-ubiquinone oxidoreductase chain 5 × 1 （O78756） NADH-ubiquinone oxidoreductase chain 4 × 1 （O78755） NADH-ubiquinone oxidoreductase chain 2 × 1 （O78748） Mitochondrial complex I, B14.7 subunit × 1 （W5PAR2） NADH:ubiquinone oxidoreductase subunit B5 × 1 （W5QHN8） Acyl carrier protein × 1 （W5NQT7） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （W5PYA5） Mitochondrial complex I, PDSW subunit × 1 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （W5QBF5） NADH:ubiquinone oxidoreductase subunit S5 × 1 （W5QFF9） NADH:ubiquinone oxidoreductase subunit A3 × 1 （W5NYM7） NADH:ubiquinone oxidoreductase subunit B3 × 1 （W5Q5T4） NADH:ubiquinone oxidoreductase subunit B4 × 1 （W5QF73） Mitochondrial complex I, B16.6 subunit × 1 Mitochondrial complex I, B17 subunit × 1 （W5PZE3） NADH:ubiquinone oxidoreductase subunit B7 × 1 （W5P5V3） NADH:ubiquinone oxidoreductase subunit B9 × 1 （W5PGA3） NADH:ubiquinone oxidoreductase subunit B2 × 1 （W5PVD7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （W5Q1B0） Mitochondrial complex I, ESSS subunit × 1 （W5PWF1） Mitochondrial complex I, KFYI subunit × 1 Mitochondrial complex I, MNLL subunit × 1 Mitochondrial complex I, MWFE subunit × 1 Mitochondrial complex I, ND4L subunit × 1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 5 2-decyl-5,6-dimethoxy-3-methylcyclohexa-2,5-diene-1,4-dione × 1 1,2-Distearoyl-sn-glycerophosphoethanolamine × 12 CARDIOLIPIN × 7 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1 ADENOSINE MONOPHOSPHATE × 1 MYRISTIC ACID × 1 water × 29	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	W5P9Q8_SHEEP
Isoform	—
PDB entities	17
Chains and sequence ranges	Author chain o； PDBConstruct 1–122； UniProt 1–122

NADH:ubiquinone oxidoreductase subunit B4

OrganismNot specified

UniProt W5QF73

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 29	NADH-ubiquinone oxidoreductase chain 3 × 1 （O78753） NADH-ubiquinone oxidoreductase chain 1 × 1 （O78747） NADH-ubiquinone oxidoreductase chain 6 × 1 （O78757） NADH-ubiquinone oxidoreductase chain 4L × 1 （O78754） NADH-ubiquinone oxidoreductase chain 5 × 1 （O78756） NADH-ubiquinone oxidoreductase chain 4 × 1 （O78755） NADH-ubiquinone oxidoreductase chain 2 × 1 （O78748） Mitochondrial complex I, B14.7 subunit × 1 （W5PAR2） NADH:ubiquinone oxidoreductase subunit B5 × 1 （W5QHN8） Acyl carrier protein × 1 （W5NQT7） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （W5PYA5） Mitochondrial complex I, PDSW subunit × 1 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （W5QBF5） NADH:ubiquinone oxidoreductase subunit S5 × 1 （W5QFF9） NADH:ubiquinone oxidoreductase subunit A3 × 1 （W5NYM7） NADH:ubiquinone oxidoreductase subunit B3 × 1 （W5Q5T4） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （W5P9Q8） Mitochondrial complex I, B16.6 subunit × 1 Mitochondrial complex I, B17 subunit × 1 （W5PZE3） NADH:ubiquinone oxidoreductase subunit B7 × 1 （W5P5V3） NADH:ubiquinone oxidoreductase subunit B9 × 1 （W5PGA3） NADH:ubiquinone oxidoreductase subunit B2 × 1 （W5PVD7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （W5Q1B0） Mitochondrial complex I, ESSS subunit × 1 （W5PWF1） Mitochondrial complex I, KFYI subunit × 1 Mitochondrial complex I, MNLL subunit × 1 Mitochondrial complex I, MWFE subunit × 1 Mitochondrial complex I, ND4L subunit × 1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 5 2-decyl-5,6-dimethoxy-3-methylcyclohexa-2,5-diene-1,4-dione × 1 1,2-Distearoyl-sn-glycerophosphoethanolamine × 12 CARDIOLIPIN × 7 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1 ADENOSINE MONOPHOSPHATE × 1 MYRISTIC ACID × 1 water × 29	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	W5QF73_SHEEP
Isoform	—
PDB entities	18
Chains and sequence ranges	Author chain p； PDBConstruct 1–130； UniProt 1–130

Mitochondrial complex I, B17 subunit

OrganismNot specified

UniProt W5PZE3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 29	NADH-ubiquinone oxidoreductase chain 3 × 1 （O78753） NADH-ubiquinone oxidoreductase chain 1 × 1 （O78747） NADH-ubiquinone oxidoreductase chain 6 × 1 （O78757） NADH-ubiquinone oxidoreductase chain 4L × 1 （O78754） NADH-ubiquinone oxidoreductase chain 5 × 1 （O78756） NADH-ubiquinone oxidoreductase chain 4 × 1 （O78755） NADH-ubiquinone oxidoreductase chain 2 × 1 （O78748） Mitochondrial complex I, B14.7 subunit × 1 （W5PAR2） NADH:ubiquinone oxidoreductase subunit B5 × 1 （W5QHN8） Acyl carrier protein × 1 （W5NQT7） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （W5PYA5） Mitochondrial complex I, PDSW subunit × 1 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （W5QBF5） NADH:ubiquinone oxidoreductase subunit S5 × 1 （W5QFF9） NADH:ubiquinone oxidoreductase subunit A3 × 1 （W5NYM7） NADH:ubiquinone oxidoreductase subunit B3 × 1 （W5Q5T4） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （W5P9Q8） NADH:ubiquinone oxidoreductase subunit B4 × 1 （W5QF73） Mitochondrial complex I, B16.6 subunit × 1 NADH:ubiquinone oxidoreductase subunit B7 × 1 （W5P5V3） NADH:ubiquinone oxidoreductase subunit B9 × 1 （W5PGA3） NADH:ubiquinone oxidoreductase subunit B2 × 1 （W5PVD7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （W5Q1B0） Mitochondrial complex I, ESSS subunit × 1 （W5PWF1） Mitochondrial complex I, KFYI subunit × 1 Mitochondrial complex I, MNLL subunit × 1 Mitochondrial complex I, MWFE subunit × 1 Mitochondrial complex I, ND4L subunit × 1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 5 2-decyl-5,6-dimethoxy-3-methylcyclohexa-2,5-diene-1,4-dione × 1 1,2-Distearoyl-sn-glycerophosphoethanolamine × 12 CARDIOLIPIN × 7 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1 ADENOSINE MONOPHOSPHATE × 1 MYRISTIC ACID × 1 water × 29	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	W5PZE3_SHEEP
Isoform	—
PDB entities	20
Chains and sequence ranges	Author chain r； PDBConstruct 1–128； UniProt 1–128

NADH:ubiquinone oxidoreductase subunit B7

OrganismNot specified

UniProt W5P5V3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 29	NADH-ubiquinone oxidoreductase chain 3 × 1 （O78753） NADH-ubiquinone oxidoreductase chain 1 × 1 （O78747） NADH-ubiquinone oxidoreductase chain 6 × 1 （O78757） NADH-ubiquinone oxidoreductase chain 4L × 1 （O78754） NADH-ubiquinone oxidoreductase chain 5 × 1 （O78756） NADH-ubiquinone oxidoreductase chain 4 × 1 （O78755） NADH-ubiquinone oxidoreductase chain 2 × 1 （O78748） Mitochondrial complex I, B14.7 subunit × 1 （W5PAR2） NADH:ubiquinone oxidoreductase subunit B5 × 1 （W5QHN8） Acyl carrier protein × 1 （W5NQT7） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （W5PYA5） Mitochondrial complex I, PDSW subunit × 1 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （W5QBF5） NADH:ubiquinone oxidoreductase subunit S5 × 1 （W5QFF9） NADH:ubiquinone oxidoreductase subunit A3 × 1 （W5NYM7） NADH:ubiquinone oxidoreductase subunit B3 × 1 （W5Q5T4） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （W5P9Q8） NADH:ubiquinone oxidoreductase subunit B4 × 1 （W5QF73） Mitochondrial complex I, B16.6 subunit × 1 Mitochondrial complex I, B17 subunit × 1 （W5PZE3） NADH:ubiquinone oxidoreductase subunit B9 × 1 （W5PGA3） NADH:ubiquinone oxidoreductase subunit B2 × 1 （W5PVD7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （W5Q1B0） Mitochondrial complex I, ESSS subunit × 1 （W5PWF1） Mitochondrial complex I, KFYI subunit × 1 Mitochondrial complex I, MNLL subunit × 1 Mitochondrial complex I, MWFE subunit × 1 Mitochondrial complex I, ND4L subunit × 1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 5 2-decyl-5,6-dimethoxy-3-methylcyclohexa-2,5-diene-1,4-dione × 1 1,2-Distearoyl-sn-glycerophosphoethanolamine × 12 CARDIOLIPIN × 7 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1 ADENOSINE MONOPHOSPHATE × 1 MYRISTIC ACID × 1 water × 29	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	W5P5V3_SHEEP
Isoform	—
PDB entities	21
Chains and sequence ranges	Author chain s； PDBConstruct 1–137； UniProt 1–137

NADH:ubiquinone oxidoreductase subunit B9

OrganismNot specified

UniProt W5PGA3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 29	NADH-ubiquinone oxidoreductase chain 3 × 1 （O78753） NADH-ubiquinone oxidoreductase chain 1 × 1 （O78747） NADH-ubiquinone oxidoreductase chain 6 × 1 （O78757） NADH-ubiquinone oxidoreductase chain 4L × 1 （O78754） NADH-ubiquinone oxidoreductase chain 5 × 1 （O78756） NADH-ubiquinone oxidoreductase chain 4 × 1 （O78755） NADH-ubiquinone oxidoreductase chain 2 × 1 （O78748） Mitochondrial complex I, B14.7 subunit × 1 （W5PAR2） NADH:ubiquinone oxidoreductase subunit B5 × 1 （W5QHN8） Acyl carrier protein × 1 （W5NQT7） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （W5PYA5） Mitochondrial complex I, PDSW subunit × 1 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （W5QBF5） NADH:ubiquinone oxidoreductase subunit S5 × 1 （W5QFF9） NADH:ubiquinone oxidoreductase subunit A3 × 1 （W5NYM7） NADH:ubiquinone oxidoreductase subunit B3 × 1 （W5Q5T4） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （W5P9Q8） NADH:ubiquinone oxidoreductase subunit B4 × 1 （W5QF73） Mitochondrial complex I, B16.6 subunit × 1 Mitochondrial complex I, B17 subunit × 1 （W5PZE3） NADH:ubiquinone oxidoreductase subunit B7 × 1 （W5P5V3） NADH:ubiquinone oxidoreductase subunit B2 × 1 （W5PVD7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （W5Q1B0） Mitochondrial complex I, ESSS subunit × 1 （W5PWF1） Mitochondrial complex I, KFYI subunit × 1 Mitochondrial complex I, MNLL subunit × 1 Mitochondrial complex I, MWFE subunit × 1 Mitochondrial complex I, ND4L subunit × 1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 5 2-decyl-5,6-dimethoxy-3-methylcyclohexa-2,5-diene-1,4-dione × 1 1,2-Distearoyl-sn-glycerophosphoethanolamine × 12 CARDIOLIPIN × 7 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1 ADENOSINE MONOPHOSPHATE × 1 MYRISTIC ACID × 1 water × 29	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	W5PGA3_SHEEP
Isoform	—
PDB entities	22
Chains and sequence ranges	Author chain t； PDBConstruct 1–179； UniProt 1–179

NADH:ubiquinone oxidoreductase subunit B2

OrganismNot specified

UniProt W5PVD7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 29	NADH-ubiquinone oxidoreductase chain 3 × 1 （O78753） NADH-ubiquinone oxidoreductase chain 1 × 1 （O78747） NADH-ubiquinone oxidoreductase chain 6 × 1 （O78757） NADH-ubiquinone oxidoreductase chain 4L × 1 （O78754） NADH-ubiquinone oxidoreductase chain 5 × 1 （O78756） NADH-ubiquinone oxidoreductase chain 4 × 1 （O78755） NADH-ubiquinone oxidoreductase chain 2 × 1 （O78748） Mitochondrial complex I, B14.7 subunit × 1 （W5PAR2） NADH:ubiquinone oxidoreductase subunit B5 × 1 （W5QHN8） Acyl carrier protein × 1 （W5NQT7） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （W5PYA5） Mitochondrial complex I, PDSW subunit × 1 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （W5QBF5） NADH:ubiquinone oxidoreductase subunit S5 × 1 （W5QFF9） NADH:ubiquinone oxidoreductase subunit A3 × 1 （W5NYM7） NADH:ubiquinone oxidoreductase subunit B3 × 1 （W5Q5T4） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （W5P9Q8） NADH:ubiquinone oxidoreductase subunit B4 × 1 （W5QF73） Mitochondrial complex I, B16.6 subunit × 1 Mitochondrial complex I, B17 subunit × 1 （W5PZE3） NADH:ubiquinone oxidoreductase subunit B7 × 1 （W5P5V3） NADH:ubiquinone oxidoreductase subunit B9 × 1 （W5PGA3） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （W5Q1B0） Mitochondrial complex I, ESSS subunit × 1 （W5PWF1） Mitochondrial complex I, KFYI subunit × 1 Mitochondrial complex I, MNLL subunit × 1 Mitochondrial complex I, MWFE subunit × 1 Mitochondrial complex I, ND4L subunit × 1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 5 2-decyl-5,6-dimethoxy-3-methylcyclohexa-2,5-diene-1,4-dione × 1 1,2-Distearoyl-sn-glycerophosphoethanolamine × 12 CARDIOLIPIN × 7 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1 ADENOSINE MONOPHOSPHATE × 1 MYRISTIC ACID × 1 water × 29	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	W5PVD7_SHEEP
Isoform	—
PDB entities	23
Chains and sequence ranges	Author chain u； PDBConstruct 1–108； UniProt 1–108

NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial

OrganismNot specified

UniProt W5Q1B0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 29	NADH-ubiquinone oxidoreductase chain 3 × 1 （O78753） NADH-ubiquinone oxidoreductase chain 1 × 1 （O78747） NADH-ubiquinone oxidoreductase chain 6 × 1 （O78757） NADH-ubiquinone oxidoreductase chain 4L × 1 （O78754） NADH-ubiquinone oxidoreductase chain 5 × 1 （O78756） NADH-ubiquinone oxidoreductase chain 4 × 1 （O78755） NADH-ubiquinone oxidoreductase chain 2 × 1 （O78748） Mitochondrial complex I, B14.7 subunit × 1 （W5PAR2） NADH:ubiquinone oxidoreductase subunit B5 × 1 （W5QHN8） Acyl carrier protein × 1 （W5NQT7） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （W5PYA5） Mitochondrial complex I, PDSW subunit × 1 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （W5QBF5） NADH:ubiquinone oxidoreductase subunit S5 × 1 （W5QFF9） NADH:ubiquinone oxidoreductase subunit A3 × 1 （W5NYM7） NADH:ubiquinone oxidoreductase subunit B3 × 1 （W5Q5T4） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （W5P9Q8） NADH:ubiquinone oxidoreductase subunit B4 × 1 （W5QF73） Mitochondrial complex I, B16.6 subunit × 1 Mitochondrial complex I, B17 subunit × 1 （W5PZE3） NADH:ubiquinone oxidoreductase subunit B7 × 1 （W5P5V3） NADH:ubiquinone oxidoreductase subunit B9 × 1 （W5PGA3） NADH:ubiquinone oxidoreductase subunit B2 × 1 （W5PVD7） Mitochondrial complex I, ESSS subunit × 1 （W5PWF1） Mitochondrial complex I, KFYI subunit × 1 Mitochondrial complex I, MNLL subunit × 1 Mitochondrial complex I, MWFE subunit × 1 Mitochondrial complex I, ND4L subunit × 1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 5 2-decyl-5,6-dimethoxy-3-methylcyclohexa-2,5-diene-1,4-dione × 1 1,2-Distearoyl-sn-glycerophosphoethanolamine × 12 CARDIOLIPIN × 7 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1 ADENOSINE MONOPHOSPHATE × 1 MYRISTIC ACID × 1 water × 29	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	W5Q1B0_SHEEP
Isoform	—
PDB entities	24
Chains and sequence ranges	Author chain v； PDBConstruct 1–186； UniProt 1–186

Mitochondrial complex I, ESSS subunit

OrganismNot specified

UniProt W5PWF1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 29	NADH-ubiquinone oxidoreductase chain 3 × 1 （O78753） NADH-ubiquinone oxidoreductase chain 1 × 1 （O78747） NADH-ubiquinone oxidoreductase chain 6 × 1 （O78757） NADH-ubiquinone oxidoreductase chain 4L × 1 （O78754） NADH-ubiquinone oxidoreductase chain 5 × 1 （O78756） NADH-ubiquinone oxidoreductase chain 4 × 1 （O78755） NADH-ubiquinone oxidoreductase chain 2 × 1 （O78748） Mitochondrial complex I, B14.7 subunit × 1 （W5PAR2） NADH:ubiquinone oxidoreductase subunit B5 × 1 （W5QHN8） Acyl carrier protein × 1 （W5NQT7） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （W5PYA5） Mitochondrial complex I, PDSW subunit × 1 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （W5QBF5） NADH:ubiquinone oxidoreductase subunit S5 × 1 （W5QFF9） NADH:ubiquinone oxidoreductase subunit A3 × 1 （W5NYM7） NADH:ubiquinone oxidoreductase subunit B3 × 1 （W5Q5T4） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （W5P9Q8） NADH:ubiquinone oxidoreductase subunit B4 × 1 （W5QF73） Mitochondrial complex I, B16.6 subunit × 1 Mitochondrial complex I, B17 subunit × 1 （W5PZE3） NADH:ubiquinone oxidoreductase subunit B7 × 1 （W5P5V3） NADH:ubiquinone oxidoreductase subunit B9 × 1 （W5PGA3） NADH:ubiquinone oxidoreductase subunit B2 × 1 （W5PVD7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （W5Q1B0） Mitochondrial complex I, KFYI subunit × 1 Mitochondrial complex I, MNLL subunit × 1 Mitochondrial complex I, MWFE subunit × 1 Mitochondrial complex I, ND4L subunit × 1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 5 2-decyl-5,6-dimethoxy-3-methylcyclohexa-2,5-diene-1,4-dione × 1 1,2-Distearoyl-sn-glycerophosphoethanolamine × 12 CARDIOLIPIN × 7 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1 ADENOSINE MONOPHOSPHATE × 1 MYRISTIC ACID × 1 water × 29	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	W5PWF1_SHEEP
Isoform	—
PDB entities	25
Chains and sequence ranges	Author chain w； PDBConstruct 1–154； UniProt 1–154

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6zka
Deposition date deposition_date	2020-06-30
Structure title title	Membrane domain of open complex I during turnover
Keywords keywords	complex, respiration, NADH, proton pump, mitochondria, iron-sulphur cluster, oxidoreductase, membrane protein, ELECTRON TRANSPORT; ELECTRON TRANSPORT
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6zka__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6zka__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6zka__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	60.66 Å
Rg (electron density)	60.40 Å
Total Rg	60.16 Å
Atom count	39507
Residues	4689
Excluded volume	721590 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6zka__assembly_1__model_1`	29-meric （29）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (37)

Entity 1 Entity 1 polymer

Description description	NADH-ubiquinone oxidoreductase chain 3
Molecular weight formula_weight	13106.5 kDa
EC 编号 ec_number	7.1.1.2
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	40800

MNLMITLLTNFTLATLLVTIAFWLPQLNVYSEKTSPYECGFDPMGSARLPFSMKFFLVAITFLLFDLEIALLLPLPWASQTTNLNTMLTMALLLIFLLAVSLAYEWTQKGLEWTE

Entity 2 Entity 2 polymer

Description description	NADH-ubiquinone oxidoreductase chain 1
Molecular weight formula_weight	35884.9 kDa
EC 编号 ec_number	7.1.1.2
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

MFMINVLTLIIPILLAVAFLTLVERKVLGYMQFRKGPNVVGPYGLLQPIADAIKLFIKEPLRPATSSISMFILAPILALTLALTMWIPLPMPYPLINMNLGVLFMLAMSSLAVYSILWSGWASNSKYALIGALRAVAQTISYEVTLAIILLSVLLMNGSFTLSTLIITQEQVWLIFPAWPLAMMWFISTLAETNRAPFDLTEGESELVSGFNVEYAAGPFALFFMAEYANIIMMNIFTTTLFLGAFHNPYMPELYTINFTIKSLLLSITFLWIRASYPRFRYDQLMHLLWKNFLPLTLALCMWHVSLPILLSSIPPQT

Entity 3 Entity 3 polymer

Description description	NADH-ubiquinone oxidoreductase chain 6
Molecular weight formula_weight	19126.6 kDa
EC 编号 ec_number	7.1.1.2
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

MMTYIVFILSIIFVMGFVGFSSKPSPIYGGLGLIVSGGVGCGIVLNFGGSFLGLMVFLIYLGGMMVVFGYTTAMATEQYPEVWVSNKVVLGTFITGLLMEFLMVYYVLKDKEVEIVFKFNGMGDWVIYDTGDSGFFSEEAMGIAALYSYGTWLVIVTGWSLLIGVVVIMEITRGN

Entity 4 Entity 4 polymer

Description description	NADH-ubiquinone oxidoreductase chain 4L
Molecular weight formula_weight	10868.2 kDa
EC 编号 ec_number	7.1.1.2
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K

MSLVYMNIMMAFTVSLTGLLMYRSHLMSSLLCLEGMMLSLFILATLMILNSHFTLASMMPIILLVFAACEAALGLSLLVMVSNTYGTDYVQNLNLLQC

Entity 5 Entity 5 polymer

Description description	NADH-ubiquinone oxidoreductase chain 5
Molecular weight formula_weight	68438.9 kDa
EC 编号 ec_number	7.1.1.2
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

MNLFSSLTLVTLILLTMPIAAINFNTHKFTNYPLYVKTTISCAFITSMIPTMMFIHTGQEMIISNWHWLTIQTLKLSLSFKMDFFSMMFVPVALFVTWSIMEFSMWYMHSDPNINQFFKYLLLFLITMLILVTANNLFQLFIGWEGVGIMSFLLIGWWYGRTDANTAALQAILYNRIGDIGFILAMAWFLINLNTWDLQQIFMLNPNDSNLPLMGLILAATGKSAQFGLHPWLPSAMEGPTPVSALLHSSTMVVAGIFLLIRFYPLTENNKFGQSIMLCLGAMTTLFTAMCALTQNDIKKIIAFSTSSQLGLMMVTIGINQPHLAFLHICTHAFFKAMLFMCSGSIIHSLNDEQDIRKMGGLFKAMPFTTTALIIGSLALTGMPFLTGFYSKDLIIESANTSYTNAWALLMTLVATSFTAIYSTRIIFFALLGQPRFPTLININENNPFLINSIKRLLIGSLFAGFIISNNIPPMTIPQMTMPHYLKMTALTVTILGFILALEISNTTHYLKFNYPSNTFKFSNLLGYYPTIMHRLTPYMNLTMSQKSASSLLDLIWLETILPKTISLAQMKMSTTITSQKGLIKLYFLSFLITILISTTLLNFHE

Entity 6 Entity 6 polymer

Description description	NADH-ubiquinone oxidoreductase chain 4
Molecular weight formula_weight	52086.7 kDa
EC 编号 ec_number	7.1.1.2
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M

MLKYIIPTMMLMPLTWLSKNSMIWINTTLHSLLISLTSLLLLNQFGDNSLNFSLTFFSDSLSTPLLILTMWLLPLMLMASQHHLSKENLARKKLFISMLILLQLFLIMTFTATELIFFYIMFEATLVPTLIIITRWGNQTERLNAGLYFLFYTLAGSLPLLVALIYIQNTMGSLNFLILQYWVQPMPNSWSNTFMWLACMMAFMVKMPLYGLHLWLPKAHVEAPIAGSMVLAAILLKLGGYGMMRITLLLNPITDFMAYPFIMLSLWGMIMTSSICLRQTDLKSLIAYSSVSHMALVIVAILIQTPWSYMGATALMIAHGLTSSMLFCLANSNYERVHSRTMILARGLQTLLPLMAAWWLLASLTNLALPPSINLIGELFVVMSTFSWSNITIILMGLNMVITALYSLYMLITTQRGKHTHHINNILPSFTRENALMSLHMLPLLLLSLNPKIILGPLY

Entity 7 Entity 7 polymer

Description description	NADH-ubiquinone oxidoreductase chain 2
Molecular weight formula_weight	39149.8 kDa
EC 编号 ec_number	7.1.1.2
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	N

MNPIILIIILMTVMLGTIIVMISTHWLLIWIGFEMNMLAIIPIMMKKHNPRATEASTKYFLTQSTASMLLMMAIIINLMFSGQWTVMKLFNPMASMLMTMALAMKLGMAPFHFWVPEVTQGIPLSSGLILLTWQKLAPMSVLYQILPSINLDLILTLSILSITIGGWGGLNQTQLRKIMAYSSIAHMGWMTAVLLYNPTMTLLNLIIYIIMTSTMFTLFMANSTTTTLSLSHTWNKAPIMTILVLITLLSMGGLPPLSGFMPKWMIIQEMTKNDSIILPTLMAITALLNLYFYMRLTYSTALTMFPSTNNMKMKWQFPTTKRMTLLPTMTVLSTMLLPLTPILSILE

Entity 8 Entity 8 polymer

Description description	Mitochondrial complex I, B14.7 subunit
Molecular weight formula_weight	14784.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	V

MAKTLLHQYWDIPEGTECHRKTYAATSIGGASGLVVSAYSVALKTPTSFLEGVARTGRYTFTAAAIGAIFGLTSCISAQVREKPDDPLNYLIGGCAGGLTLGARTRSYGIGAAACAYMGLTAALVKMGQLEGWKVFAEPKV

Entity 9 Entity 9 polymer

Description description	NADH:ubiquinone oxidoreductase subunit B5
Molecular weight formula_weight	21614.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	W

MAAMSLLHRASVSAVVALSGRRLGTRLGFGGFLTRDFPKTVAPVRHSGDHGKRLFIIKPSGFYDKRFLKLLRFYILLTGIPVVIGITLINVFIGEAELAEIPEGYVPEHWEYFKHPISRWIARTFFDAPEKNYERTMAILQIESEKAELRLKELEVRRLMRAKGDGPWFQYPTIDKALIDHSPKATPDN

Entity 10 Entity 10 polymer

Description description	Acyl carrier protein
Molecular weight formula_weight	17608.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	X

VEVKDFYTTNYQTAVSFSPLGPMPSMALMAVSLSGANVPKSGGRPEESRVPVLTQRKVPGRVTPLCRQYSDAPPLTLEGIKDRVLYVLKLYDKIDPEKLSVNSHFMKDLGLDSLDQVEIIMAMEDEFGFEIPDIDAEKLMCPQEIVDYIADKKDVYE

Entity 11 Entity 11 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8
Molecular weight formula_weight	20139.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Y

MPGIVELPSLEDLKVQEVKVSSSVLKAAAHHYGAQCDKPNKEFMLCRWEEKDPRRCLEEGKLVNQCALEFFRQIKRHCAEPFTEYWTCIDYSGLQLFRRCRKEQAQFDKCVLDKLGWVRPDLGELSKVTKVKTDRPLPENPYHSRARPEPNPEVEGDLKPARHGSRLFFWTM

Entity 12 Entity 12 polymer

Description description	Mitochondrial complex I, PDSW subunit
Molecular weight formula_weight	20880.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Z

PDSWDKDVYPEPPRRTPAPSPQTSLPNPITYLTKAFDLLVDRPVTLVREFIERQHAKNKYYYYHREFRRVPDITECHEKDVLCMFEAEMQWKRDYKVDQEIVNIIQERLKACQQREGESHRQNCAKELQQFTQVVKAYQDRYHDLGAHYSARKCLAKQKQRMLAERKATKEAAAA

Entity 13 Entity 13 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial
Molecular weight formula_weight	40557.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	k

MALRFLRLVPASAASRGLAAVPPRVGGIHTSVQRKLQYGPLAYILGEKTTKKMTENSKLITVDGNICSGKSKLAKEVAEKLGLKHFPEAGIHYADSTTGDGKPLPVRFSGNCSLEKFYDDPKSNDGNSYRLQAWLYASRLLQYADALEHLLSTGQGVVLERSIYSDFVFLEAMYRQGFIRKQCVDHYNQVKKVTVCEYLPPHVVIYVDVPVSEVQSRIQKKGNPHEMKITSAYLQDIENVYKGTFLPEMSEKCEVLQYSAWEAEDAEKVVEDIQYLKYDKGPWLDQDDRKLHNLRMLVQDKLEVLNYTSIPVFLPEVTIGAHQSDRVFQEFTELPGRKYRAGYNEDVGDKWIWLK

Entity 14 Entity 14 polymer

Description description	NADH:ubiquinone oxidoreductase subunit S5
Molecular weight formula_weight	12605.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	l

MPFFDVQKKLGVDLDHWMTIQSAEQPHRIPARCHAFEKEWIECAHGIGSIRAEKECKIEFEDFRECLLRQKTMKRLNAIKRQRDKLIKEGKYTPPPHHSGQEDLRP

Entity 15 Entity 15 polymer

Description description	NADH:ubiquinone oxidoreductase subunit A3
Molecular weight formula_weight	9325.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	m

MAPRVAAFLKNVWAKEPVLVASFAIAGLAVILPTLSPYTKYSLMINRATPYNYPVPLRDDGNMPDVPSHPQDPQGPSLEWLKRL

Entity 16 Entity 16 polymer

Description description	NADH:ubiquinone oxidoreductase subunit B3
Molecular weight formula_weight	11146.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	n

MAHGHGHEHGPSKMELPDYKQWKIEGTPLETVQEKLAARGLRDPWGRNEAWRYMGGFANNVSFVGALLKGFKWGFAAFVVAVGAEYYLESQKKDKKHH

Entity 17 Entity 17 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 subunit C2
Molecular weight formula_weight	14431.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	o

VTMMTGRQARAPLQFLPDEARSLPPPKLTDPRLAYIGFLGYCSGLIDNAIRRRPVLSAGLHRQFLYITSFVFVGYYLLKRQDYMYAVRDHDMFSYIKSHPEDFPEKDKKTYREVFEEFHPVR

Entity 18 Entity 18 polymer

Description description	NADH:ubiquinone oxidoreductase subunit B4
Molecular weight formula_weight	15236.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	p

KMSFPKYEPSRLASLPTTLDPAEYDISSETRKAQAERLAIRSRLKREYQLQYNDPSRRGVVEDPALIRWTCARSANVYPNFRPNTKTSLLGALFGIGPLIFWYYVFKTDRDRKEKLIQEGKLDRTFNISY

Entity 19 Entity 19 polymer

Description description	Mitochondrial complex I, B16.6 subunit
Molecular weight formula_weight	16766.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	q

MAASKVKQDMPPVGGYGPIDYKRNLPRRGLSGYSMFAVGIGALLFGYWSMMRWNRERRRLQIEDFEARIALMPLLQAEKDRRVLQMLRENLEEEATIMKDVPGWKVGESVFHTTRWVTPMMGELYGLRTGEEILSSTYGFIWYT

Entity 20 Entity 20 polymer

Description description	Mitochondrial complex I, B17 subunit
Molecular weight formula_weight	15565.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	r

MSGYTPDEKLRLQQLRELRRRWLKDQELSPREPVLPPRRVSPVERFWNKFLQDGALWKNVIYKTYRHSIFAFTHVLIPVWIIHYYLKYHVTTKPYTIVEKKPRIFPGDTILETGEVIPPMKEFPDQHH

Entity 21 Entity 21 polymer

Description description	NADH:ubiquinone oxidoreductase subunit B7
Molecular weight formula_weight	16413.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	s

MGAHLARRYLGDASVEPEPLRMPTFPPDYGFPERKEREMVATQQEMNDAQLVLQQRDYCAHYLIRFLKCKRDSFPNFLACKHEQHDWDYCEHLDYVKRMKEFERERRLLQRKKRREQREADMAKGLGPGEVAPEVAL

Entity 22 Entity 22 polymer

Description description	NADH:ubiquinone oxidoreductase subunit B9
Molecular weight formula_weight	21779.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	t

MAFLPSAAYLTHQQKVLQLYKRALRHLESRCVHRDKYRYFACLLRARFDEHKNEKDMVKATQLLREAEKEFWHGQHPQPYIFPESPGGTSYERYECYKVPEWCLDDWHPSEKAMYPDYFAKREQWKKLRRESWEREVKQLQEETPVGGPRTEALPPARKQGDLPPLWWHIVTRPRERPM

Entity 23 Entity 23 polymer

Description description	NADH:ubiquinone oxidoreductase subunit B2
Molecular weight formula_weight	12226.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	u

MAGMSALKRLAPFAHVGGHLFRGRCARAVGAGGVRRAGGGAHIEPRYRQFPQLTRSQVIQAEFFSATMWFWILWRFWHDSDAVLGHFPYPDPSQWTDEELGIPPDDED

Entity 24 Entity 24 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial
Molecular weight formula_weight	21752.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	v

MAAARAGVLGIRWLQKAARNVVPLGARTASHITKDMLPGPYPKTPEERAAAAKKYNMRVEDYEPYPDDGMGYGDYPKLPDRSQQERDPWYDWDHPDLRLNWGEPMHWDLDMYIRNRVDTSPTPVNWNLMCKHLFGFVAFMLFMFWVGETYPTYQPVGPKQYPYNNLYLERGGDPNKEPEPVVHYEI

Entity 25 Entity 25 polymer

Description description	Mitochondrial complex I, ESSS subunit
Molecular weight formula_weight	17410.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	w

MAAGMLGLCGRRLLAVAATRGLPAASVRWESSSSRAVIAPSTLAGKRPSEPTLRWQEDPEPEDENLYEKNPDSHGYDKDPAVDVWNMRVVFFFGFSIVLVLGSTFVAYLPDYRMQEWARREAERLVKYREAHGLPLMESNCFDPSKIQLPEDED

Entity 26 Entity 26 polymer

Description description	Mitochondrial complex I, KFYI subunit
Molecular weight formula_weight	8802.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	x

MAPSAFLRPFWKLLAPARFPSVSSSRSKFYIQEPPHGSPNWLKVGLTLGTSAFLWIYLIKQHNEDVLEYKRRNGLE

Entity 27 Entity 27 polymer

Description description	Mitochondrial complex I, MNLL subunit
Molecular weight formula_weight	7075.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	y

MMNLLQVVRDHWIHVLVPVGFVFGYYLDRKNDEKLAAFRNKSLLYKRELKPQEEVTWK

Entity 28 Entity 28 polymer

Description description	Mitochondrial complex I, MWFE subunit
Molecular weight formula_weight	8211.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	z

MWFEVLPGIAVMGVCLFIPGMATARIHRFSNGGREKRVAHYSYQWYLMERDRRVSGVNRYYVSKGLENID

Entity 29 Entity 29 polymer

Description description	Mitochondrial complex I, ND4L subunit
Molecular weight formula_weight	52634.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	4

MAALRALRRLRGAAAQVLRPGAGARLPIQPSRGARQWQPDVEWAEQYGGAVMYPTKETAHWKPPPWNDVDPPKDTLVSNLTLNFGPQHPAAHGVLRLVMELSGEMVRKCDPHIGLLHRGTEKLIEYKTYLQALPYFDRLDYVSMMCNEQAYSLAVEKLLNIQPPPRAQWIRVLFGEITRLLNHIMAVTTHALDIGAMTPFFWMFEEREKMFEFYERVSGARMHAAYVRPGGVHQDLPLGLMDDIYEFSKNFSLRIDELEEMLTNNRIWRNRTVDIGVVTAEDALNYGFSGVMLRGSGIQWDLRKTQPYDVYDQVEFDVPIGSRGDCYDRYLCRVEEMRQSIRIISQCLNKMPPGEIKVDDAKVSPPKRAEMKTSMESLIHHFKLYTEGYQVPPGATYTAIEAPKGEFGVYLVSDGSSRPYRCKIKAPGFAHLAGLDKMSKGHMLADVVAIIGTQDIVFGEVDR

Entity 30 Entity 30 non-polymer

Description description	1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE
Molecular weight formula_weight	790.1 kDa
Source method src_method	nat
Copy count entity_count	5

Entity 31 Entity 31 non-polymer

Description description	2-decyl-5,6-dimethoxy-3-methylcyclohexa-2,5-diene-1,4-dione
Molecular weight formula_weight	322.4 kDa
Source method src_method	nat
Copy count entity_count	1

Entity 32 Entity 32 non-polymer

Description description	1,2-Distearoyl-sn-glycerophosphoethanolamine
Molecular weight formula_weight	748.1 kDa
Source method src_method	syn
Copy count entity_count	12

Entity 33 Entity 33 non-polymer

Description description	CARDIOLIPIN
Molecular weight formula_weight	1464.0 kDa
Source method src_method	syn
Copy count entity_count	7

Entity 34 Entity 34 non-polymer

Description description	S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate
Molecular weight formula_weight	568.7 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 35 Entity 35 non-polymer

Description description	ADENOSINE MONOPHOSPHATE
Molecular weight formula_weight	347.2 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 36 Entity 36 non-polymer

Description description	MYRISTIC ACID
Molecular weight formula_weight	228.4 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 37 Entity 37 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	1293

▼

6. Fold Classification (SCOP + CATH) 2 domains

SCOP 2.08 (1 domains)

Domain ID domain_id	d6zkax_
Class class	a — All alpha proteins
Fold Fold fold	a.28 — Acyl carrier protein-like
Superfamily Superfamily superfamily	a.28.1 — ACP-like
Family Family family	a.28.1.0 — automated matches

CATH v4.4 (1 domains)

Domain ID domain_id	6zkaJ01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	120 — Four Helix Bundle (Hemerythrin (Met), subunit A)
Homologous superfamily homologous superfamily	1200 — NADH-ubiquinone/plastoquinone oxidoreductase chain 6, subunit NuoJ

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	2.50 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	315484

Membrane domain of open complex I during turnover

1. Protein Identity and Related Structures Protein Identity & Related Structures

NADH-ubiquinone oxidoreductase chain 3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

NADH-ubiquinone oxidoreductase chain 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

NADH-ubiquinone oxidoreductase chain 6

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

NADH-ubiquinone oxidoreductase chain 4L

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

NADH-ubiquinone oxidoreductase chain 5

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

NADH-ubiquinone oxidoreductase chain 4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

NADH-ubiquinone oxidoreductase chain 2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Mitochondrial complex I, B14.7 subunit

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

NADH:ubiquinone oxidoreductase subunit B5

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Acyl carrier protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer