SAXSdb — 7adz

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

cap protein (Algo1)

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 30	cap adaptor protein (Algo2) × 6 （A3HTC3） Phage tail protein × 12 （A3HTC1） Putative phage tail sheath protein FI × 6 （A3HTC2）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A3HTC4_9BACT
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain 0A； PDBConstruct 1–197； UniProt 1–197 Author chain 0B； PDBConstruct 1–197； UniProt 1–197 Author chain 0C； PDBConstruct 1–197； UniProt 1–197 Author chain 0D； PDBConstruct 1–197； UniProt 1–197 Author chain 0E； PDBConstruct 1–197； UniProt 1–197 Author chain 0F； PDBConstruct 1–197； UniProt 1–197

cap adaptor protein (Algo2)

OrganismNot specified

UniProt A3HTC3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 30	cap protein (Algo1) × 6 （A3HTC4） Phage tail protein × 12 （A3HTC1） Putative phage tail sheath protein FI × 6 （A3HTC2）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A3HTC3_9BACT
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain 1A； PDBConstruct 1–284； UniProt 1–284 Author chain 1B； PDBConstruct 1–284； UniProt 1–284 Author chain 1C； PDBConstruct 1–284； UniProt 1–284 Author chain 1D； PDBConstruct 1–284； UniProt 1–284 Author chain 1E； PDBConstruct 1–284； UniProt 1–284 Author chain 1F； PDBConstruct 1–284； UniProt 1–284

Phage tail protein

OrganismNot specified

UniProt A3HTC1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 30	cap protein (Algo1) × 6 （A3HTC4） cap adaptor protein (Algo2) × 6 （A3HTC3） Putative phage tail sheath protein FI × 6 （A3HTC2）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A3HTC1_9BACT
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain 1a； PDBConstruct 1–142； UniProt 1–142 Author chain 1b； PDBConstruct 1–142； UniProt 1–142 Author chain 1c； PDBConstruct 1–142； UniProt 1–142 Author chain 1d； PDBConstruct 1–142； UniProt 1–142 Author chain 1e； PDBConstruct 1–142； UniProt 1–142 Author chain 1f； PDBConstruct 1–142； UniProt 1–142 Author chain 2a； PDBConstruct 1–142； UniProt 1–142 Author chain 2b； PDBConstruct 1–142； UniProt 1–142 Author chain 2c； PDBConstruct 1–142； UniProt 1–142 Author chain 2d； PDBConstruct 1–142； UniProt 1–142 Author chain 2e； PDBConstruct 1–142； UniProt 1–142 Author chain 2f； PDBConstruct 1–142； UniProt 1–142

Putative phage tail sheath protein FI

OrganismNot specified

UniProt A3HTC2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 30	cap protein (Algo1) × 6 （A3HTC4） cap adaptor protein (Algo2) × 6 （A3HTC3） Phage tail protein × 12 （A3HTC1）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A3HTC2_9BACT
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain 2A； PDBConstruct 1–692； UniProt 1–692 Author chain 2B； PDBConstruct 1–692； UniProt 1–692 Author chain 2C； PDBConstruct 1–692； UniProt 1–692 Author chain 2D； PDBConstruct 1–692； UniProt 1–692 Author chain 2E； PDBConstruct 1–692； UniProt 1–692 Author chain 2F； PDBConstruct 1–692； UniProt 1–692

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7adz
Deposition date deposition_date	2020-09-17
Structure title title	Cryo-EM structure of an extracellular contractile injection system in marine bacterium Algoriphagus machipongonensis, the cap portion in extended state.
Keywords keywords	extracellular contractile injection system, STRUCTURAL PROTEIN; STRUCTURAL PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7adz__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7adz__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7adz__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	70.77 Å
Rg (electron density)	69.88 Å
Total Rg	70.01 Å
Atom count	67794
Residues	8508
Excluded volume	1206500 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7adz__assembly_1__model_1`	30-meric （30）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	cap protein (Algo1)
Molecular weight formula_weight	22981.1 kDa
Source method src_method	nat
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	0A,0B,0C,0D,0E,0F
Atom count atom_count	67794

MIFEVLKILTDEVNQNFKGLEMEDSEVVLNNVALIDSQQDVATELQNKVILSMINLREEVTMKNFPNNVLEGTKVTYKNPKLNINLFLIFCANRTGYKKSLSDLSRILEFFQHKSVFTQSNTSFDRDLEEMENVKNFRFTMELFTPTFEELNYIWGTLGGRQYPSVFYKLNLIVIDRDATTSEEGVITNIHRNYETL

Entity 2 Entity 2 polymer

Description description	cap adaptor protein (Algo2)
Molecular weight formula_weight	33083.4 kDa
Source method src_method	nat
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	1A,1B,1C,1D,1E,1F

MQVSSSFRSFLKLDILHSYFLNDGEKDFSSMNEEESKTQLKSYNWKDFLEIYPSQKTSHMMRGNKIFFKSFNDSIILAIKVESGTENQPFNELYEDESMTFLLSLKDQYFGNYTDLDLADQLLYFSNKTPVLPEAFTFKPIDRINQSGTVGEEYLYEGENKKHLLEEAHLNPGGGVLGIIQIYMKGDTPVLSLINNDGTLKNSLPHFKIHFSNRKSTWKYINLKDDFETETKKDYPLTKFGFILLDKKSDFISPPAHFEKYVFPNPDARRIKITPTKNYSEIFI

Entity 3 Entity 3 polymer

Description description	Phage tail protein
Molecular weight formula_weight	16375.5 kDa
Source method src_method	nat
Copy count entity_count	12

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	1a,1b,1c,1d,1e,1f,2a,2b,2c,2d,2e,2f

MSYPLSKFHFSVEWGGTKIGFTEVSGLDLETEIIEYRHGASPEYSKIKMPGMQKFSNITLKRGTFKSDNEYFQWYNTINLNKVERRDLTISLLNEEHEPVVTWKVKNAWPLKVQSTDLKGDGNEVAIESMELAHEGLVIQNE

Entity 4 Entity 4 polymer

Description description	Putative phage tail sheath protein FI
Molecular weight formula_weight	76319.0 kDa
Source method src_method	nat
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	2A,2B,2C,2D,2E,2F

MATYKTPGVYIEEITKFPPSVAQVETAIPAFIGYTQFARTKPSVDSDDLILKPKRISSLLDFTTYYGGAQNEQGITVKLTDTLIEGAENRTINVPEPTFKSPYLMFYSLQMYFANGGGPCYIVSTGVYDDWSDSETPPTINFSDLESGLAVIRKEDEPTLLLFPDATNLPTDDEFYSLYNSALMQCNDLQDRFTILDTYSDQTYNDGVEDLDPIPALRNGINLTKDYLKYGAAYYPFVQTILNYQYSADEIVIQHLSYNPNAIATALDNLNAVNGPTFIDAILDDLRDLSLPDISGEISDAVGFMYDDVDGFDIDGTFTTNSVKVANFASLVESVLSTLNELIDAKEEINKDVNSAIASSEEDNAIKTAISDALDVFNEDFEGADKIESVAKNLSDLLIKIKQADTNTKVENVLSINALNFSAEFEKLLTYDVNTGLTASVTLDLFANIGTRLDDIIAAVSAAEPIDVNNGKLNGRLLSDIEPLDNATYNTILLEINSHKVTLPPSSSMAGAYARVDNDRGVWKSPANIGLNYVSKPSVTVSHEEQESMNVHGTGKSVNAIRSFVGKGTLVWGARTLAGNDNEWRYISVRRFFNMAEESIKKATEQFVFEPNDGNTWVRVRAMIENFLILQWRAGALAGAKPEHAFYVKVGLGQTMTAQDILEGNMNVEIGLAVVRPAEFIILKFSHKMQES

▶

Resolution resolution	2.50 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	65059

Cryo-EM structure of an extracellular contractile injection system in marine bacterium Algoriphagus machipongonensis, the cap portion in extended state.

1. Protein Identity and Related Structures Protein Identity & Related Structures

cap protein (Algo1)

State in the Current Structure

Other States of the Same Protein in the Database

cap adaptor protein (Algo2)

State in the Current Structure

Other States of the Same Protein in the Database

Phage tail protein

State in the Current Structure

Other States of the Same Protein in the Database

Putative phage tail sheath protein FI

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7adz__assembly_1__model_1

7adz__assembly_1__model_1 | I(q)

7adz__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

7. Citations (1)

Cryo-EM structure of an extracellular contractile injection system in marine bacterium Algoriphagus machipongonensis, the cap portion in extended state.

1. Protein Identity and Related Structures Protein Identity & Related Structures

cap protein (Algo1)

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

cap adaptor protein (Algo2)

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Phage tail protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Putative phage tail sheath protein FI

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7adz__assembly_1__model_1

7adz__assembly_1__model_1 | I(q)

7adz__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

7. Citations (1)