SAXSdb — 7ae0

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Putative phage tail sheath protein FI

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 36	Phage tail protein × 18 （A3HTC1）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A3HTC2_9BACT
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain 3A； PDBConstruct 1–692； UniProt 1–692 Author chain 3B； PDBConstruct 1–692； UniProt 1–692 Author chain 3C； PDBConstruct 1–692； UniProt 1–692 Author chain 3D； PDBConstruct 1–692； UniProt 1–692 Author chain 3E； PDBConstruct 1–692； UniProt 1–692 Author chain 3F； PDBConstruct 1–692； UniProt 1–692 Author chain 4A； PDBConstruct 1–692； UniProt 1–692 Author chain 4B； PDBConstruct 1–692； UniProt 1–692 Author chain 4C； PDBConstruct 1–692； UniProt 1–692 Author chain 4D； PDBConstruct 1–692； UniProt 1–692 Author chain 4E； PDBConstruct 1–692； UniProt 1–692 Author chain 4F； PDBConstruct 1–692； UniProt 1–692 Author chain 5A； PDBConstruct 1–692； UniProt 1–692 Author chain 5B； PDBConstruct 1–692； UniProt 1–692 Author chain 5C； PDBConstruct 1–692； UniProt 1–692 Author chain 5D； PDBConstruct 1–692； UniProt 1–692 Author chain 5E； PDBConstruct 1–692； UniProt 1–692 Author chain 5F； PDBConstruct 1–692； UniProt 1–692

Phage tail protein

OrganismNot specified

UniProt A3HTC1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 36	Putative phage tail sheath protein FI × 18 （A3HTC2）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A3HTC1_9BACT
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain 3a； PDBConstruct 1–142； UniProt 1–142 Author chain 3b； PDBConstruct 1–142； UniProt 1–142 Author chain 3c； PDBConstruct 1–142； UniProt 1–142 Author chain 3d； PDBConstruct 1–142； UniProt 1–142 Author chain 3e； PDBConstruct 1–142； UniProt 1–142 Author chain 3f； PDBConstruct 1–142； UniProt 1–142 Author chain 4a； PDBConstruct 1–142； UniProt 1–142 Author chain 4b； PDBConstruct 1–142； UniProt 1–142 Author chain 4c； PDBConstruct 1–142； UniProt 1–142 Author chain 4d； PDBConstruct 1–142； UniProt 1–142 Author chain 4e； PDBConstruct 1–142； UniProt 1–142 Author chain 4f； PDBConstruct 1–142； UniProt 1–142 Author chain 5a； PDBConstruct 1–142； UniProt 1–142 Author chain 5b； PDBConstruct 1–142； UniProt 1–142 Author chain 5c； PDBConstruct 1–142； UniProt 1–142 Author chain 5d； PDBConstruct 1–142； UniProt 1–142 Author chain 5e； PDBConstruct 1–142； UniProt 1–142 Author chain 5f； PDBConstruct 1–142； UniProt 1–142

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7ae0
Deposition date deposition_date	2020-09-17
Structure title title	Cryo-EM structure of an extracellular contractile injection system in marine bacterium Algoriphagus machipongonensis, the sheath-tube module in extended state.
Keywords keywords	extracellular contractile injection system, STRUCTURAL PROTEIN; STRUCTURAL PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7ae0__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7ae0__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7ae0__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	75.61 Å
Rg (electron density)	74.65 Å
Total Rg	74.81 Å
Atom count	92718
Residues	11736
Excluded volume	1646900 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7ae0__assembly_1__model_1`	36-meric （36）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Description description	Putative phage tail sheath protein FI
Molecular weight formula_weight	76319.0 kDa
Source method src_method	nat
Copy count entity_count	18

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	3A,3B,3C,3D,3E,3F,4A,4B,4C,4D,4E,4F,5A,5B,5C,5D,5E,5F
Atom count atom_count	92718

MATYKTPGVYIEEITKFPPSVAQVETAIPAFIGYTQFARTKPSVDSDDLILKPKRISSLLDFTTYYGGAQNEQGITVKLTDTLIEGAENRTINVPEPTFKSPYLMFYSLQMYFANGGGPCYIVSTGVYDDWSDSETPPTINFSDLESGLAVIRKEDEPTLLLFPDATNLPTDDEFYSLYNSALMQCNDLQDRFTILDTYSDQTYNDGVEDLDPIPALRNGINLTKDYLKYGAAYYPFVQTILNYQYSADEIVIQHLSYNPNAIATALDNLNAVNGPTFIDAILDDLRDLSLPDISGEISDAVGFMYDDVDGFDIDGTFTTNSVKVANFASLVESVLSTLNELIDAKEEINKDVNSAIASSEEDNAIKTAISDALDVFNEDFEGADKIESVAKNLSDLLIKIKQADTNTKVENVLSINALNFSAEFEKLLTYDVNTGLTASVTLDLFANIGTRLDDIIAAVSAAEPIDVNNGKLNGRLLSDIEPLDNATYNTILLEINSHKVTLPPSSSMAGAYARVDNDRGVWKSPANIGLNYVSKPSVTVSHEEQESMNVHGTGKSVNAIRSFVGKGTLVWGARTLAGNDNEWRYISVRRFFNMAEESIKKATEQFVFEPNDGNTWVRVRAMIENFLILQWRAGALAGAKPEHAFYVKVGLGQTMTAQDILEGNMNVEIGLAVVRPAEFIILKFSHKMQES

Entity 2 Entity 2 polymer

Description description	Phage tail protein
Molecular weight formula_weight	16375.5 kDa
Source method src_method	nat
Copy count entity_count	18

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	3a,3b,3c,3d,3e,3f,4a,4b,4c,4d,4e,4f,5a,5b,5c,5d,5e,5f

MSYPLSKFHFSVEWGGTKIGFTEVSGLDLETEIIEYRHGASPEYSKIKMPGMQKFSNITLKRGTFKSDNEYFQWYNTINLNKVERRDLTISLLNEEHEPVVTWKVKNAWPLKVQSTDLKGDGNEVAIESMELAHEGLVIQNE

▶

Resolution resolution	2.40 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	225305

Cryo-EM structure of an extracellular contractile injection system in marine bacterium Algoriphagus machipongonensis, the sheath-tube module in extended state.

1. Protein Identity and Related Structures Protein Identity & Related Structures

Putative phage tail sheath protein FI

State in the Current Structure

Other States of the Same Protein in the Database

Phage tail protein

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7ae0__assembly_1__model_1

7ae0__assembly_1__model_1 | I(q)

7ae0__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

7. Citations (1)

Cryo-EM structure of an extracellular contractile injection system in marine bacterium Algoriphagus machipongonensis, the sheath-tube module in extended state.

1. Protein Identity and Related Structures Protein Identity & Related Structures

Putative phage tail sheath protein FI

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Phage tail protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7ae0__assembly_1__model_1

7ae0__assembly_1__model_1 | I(q)

7ae0__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

7. Citations (1)