7aod

Schizosaccharomyces pombe RNA polymerase I (dimer)

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

DNA-directed RNA polymerase I subunit rpa1

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 24	Probable DNA-directed RNA polymerase I subunit RPA2 × 2 （Q9P7X8） DNA-directed RNA polymerases I and III subunit RPAC1 × 2 （O94616） DNA-directed RNA polymerase I subunit rpa14 × 2 （Q9P7P1） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 2 （Q09191） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 2 （P36595） DNA-directed RNA polymerase I subunit rpa43 × 2 （O43036） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 2 （Q92399） DNA-directed RNA polymerase I subunit RPA12 × 2 （O94703） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 2 （O13877） DNA-directed RNA polymerases I and III subunit RPAC2 × 2 （Q09177） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 2 （P48011） ZINC ION × 12	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPA1_SCHPO
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–1689； UniProt 1–1689 Author chain M； PDBConstruct 1–1689； UniProt 1–1689

Probable DNA-directed RNA polymerase I subunit RPA2

OrganismNot specified

UniProt Q9P7X8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 24	DNA-directed RNA polymerase I subunit rpa1 × 2 （P15398） DNA-directed RNA polymerases I and III subunit RPAC1 × 2 （O94616） DNA-directed RNA polymerase I subunit rpa14 × 2 （Q9P7P1） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 2 （Q09191） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 2 （P36595） DNA-directed RNA polymerase I subunit rpa43 × 2 （O43036） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 2 （Q92399） DNA-directed RNA polymerase I subunit RPA12 × 2 （O94703） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 2 （O13877） DNA-directed RNA polymerases I and III subunit RPAC2 × 2 （Q09177） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 2 （P48011） ZINC ION × 12	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPA2_SCHPO
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–1174； UniProt 1–1174 Author chain N； PDBConstruct 1–1174； UniProt 1–1174

DNA-directed RNA polymerases I and III subunit RPAC1

OrganismNot specified

UniProt O94616

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 24	DNA-directed RNA polymerase I subunit rpa1 × 2 （P15398） Probable DNA-directed RNA polymerase I subunit RPA2 × 2 （Q9P7X8） DNA-directed RNA polymerase I subunit rpa14 × 2 （Q9P7P1） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 2 （Q09191） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 2 （P36595） DNA-directed RNA polymerase I subunit rpa43 × 2 （O43036） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 2 （Q92399） DNA-directed RNA polymerase I subunit RPA12 × 2 （O94703） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 2 （O13877） DNA-directed RNA polymerases I and III subunit RPAC2 × 2 （Q09177） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 2 （P48011） ZINC ION × 12	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPAC1_SCHPO
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–348； UniProt 1–348 Author chain O； PDBConstruct 1–348； UniProt 1–348

DNA-directed RNA polymerase I subunit rpa14

OrganismNot specified

UniProt Q9P7P1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 24	DNA-directed RNA polymerase I subunit rpa1 × 2 （P15398） Probable DNA-directed RNA polymerase I subunit RPA2 × 2 （Q9P7X8） DNA-directed RNA polymerases I and III subunit RPAC1 × 2 （O94616） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 2 （Q09191） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 2 （P36595） DNA-directed RNA polymerase I subunit rpa43 × 2 （O43036） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 2 （Q92399） DNA-directed RNA polymerase I subunit RPA12 × 2 （O94703） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 2 （O13877） DNA-directed RNA polymerases I and III subunit RPAC2 × 2 （Q09177） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 2 （P48011） ZINC ION × 12	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPA14_SCHPO
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 1–147； UniProt 1–147 Author chain P； PDBConstruct 1–147； UniProt 1–147

DNA-directed RNA polymerases I, II, and III subunit RPABC1

OrganismNot specified

UniProt Q09191

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 24	DNA-directed RNA polymerase I subunit rpa1 × 2 （P15398） Probable DNA-directed RNA polymerase I subunit RPA2 × 2 （Q9P7X8） DNA-directed RNA polymerases I and III subunit RPAC1 × 2 （O94616） DNA-directed RNA polymerase I subunit rpa14 × 2 （Q9P7P1） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 2 （P36595） DNA-directed RNA polymerase I subunit rpa43 × 2 （O43036） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 2 （Q92399） DNA-directed RNA polymerase I subunit RPA12 × 2 （O94703） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 2 （O13877） DNA-directed RNA polymerases I and III subunit RPAC2 × 2 （Q09177） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 2 （P48011） ZINC ION × 12	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPAB1_SCHPO
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain E； PDBConstruct 1–210； UniProt 1–210 Author chain Q； PDBConstruct 1–210； UniProt 1–210

DNA-directed RNA polymerases I, II, and III subunit RPABC2

OrganismNot specified

UniProt P36595

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 24	DNA-directed RNA polymerase I subunit rpa1 × 2 （P15398） Probable DNA-directed RNA polymerase I subunit RPA2 × 2 （Q9P7X8） DNA-directed RNA polymerases I and III subunit RPAC1 × 2 （O94616） DNA-directed RNA polymerase I subunit rpa14 × 2 （Q9P7P1） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 2 （Q09191） DNA-directed RNA polymerase I subunit rpa43 × 2 （O43036） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 2 （Q92399） DNA-directed RNA polymerase I subunit RPA12 × 2 （O94703） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 2 （O13877） DNA-directed RNA polymerases I and III subunit RPAC2 × 2 （Q09177） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 2 （P48011） ZINC ION × 12	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPAB2_SCHPO
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain F； PDBConstruct 1–142； UniProt 1–142 Author chain R； PDBConstruct 1–142； UniProt 1–142

DNA-directed RNA polymerase I subunit rpa43

OrganismNot specified

UniProt O43036

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 24	DNA-directed RNA polymerase I subunit rpa1 × 2 （P15398） Probable DNA-directed RNA polymerase I subunit RPA2 × 2 （Q9P7X8） DNA-directed RNA polymerases I and III subunit RPAC1 × 2 （O94616） DNA-directed RNA polymerase I subunit rpa14 × 2 （Q9P7P1） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 2 （Q09191） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 2 （P36595） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 2 （Q92399） DNA-directed RNA polymerase I subunit RPA12 × 2 （O94703） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 2 （O13877） DNA-directed RNA polymerases I and III subunit RPAC2 × 2 （Q09177） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 2 （P48011） ZINC ION × 12	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPA43_SCHPO
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain G； PDBConstruct 1–173； UniProt 1–173 Author chain S； PDBConstruct 1–173； UniProt 1–173

DNA-directed RNA polymerases I, II, and III subunit RPABC3

OrganismNot specified

UniProt Q92399

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 24	DNA-directed RNA polymerase I subunit rpa1 × 2 （P15398） Probable DNA-directed RNA polymerase I subunit RPA2 × 2 （Q9P7X8） DNA-directed RNA polymerases I and III subunit RPAC1 × 2 （O94616） DNA-directed RNA polymerase I subunit rpa14 × 2 （Q9P7P1） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 2 （Q09191） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 2 （P36595） DNA-directed RNA polymerase I subunit rpa43 × 2 （O43036） DNA-directed RNA polymerase I subunit RPA12 × 2 （O94703） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 2 （O13877） DNA-directed RNA polymerases I and III subunit RPAC2 × 2 （Q09177） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 2 （P48011） ZINC ION × 12	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPAB3_SCHPO
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain H； PDBConstruct 1–125； UniProt 1–125 Author chain T； PDBConstruct 1–125； UniProt 1–125

DNA-directed RNA polymerase I subunit RPA12

OrganismNot specified

UniProt O94703

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 24	DNA-directed RNA polymerase I subunit rpa1 × 2 （P15398） Probable DNA-directed RNA polymerase I subunit RPA2 × 2 （Q9P7X8） DNA-directed RNA polymerases I and III subunit RPAC1 × 2 （O94616） DNA-directed RNA polymerase I subunit rpa14 × 2 （Q9P7P1） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 2 （Q09191） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 2 （P36595） DNA-directed RNA polymerase I subunit rpa43 × 2 （O43036） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 2 （Q92399） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 2 （O13877） DNA-directed RNA polymerases I and III subunit RPAC2 × 2 （Q09177） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 2 （P48011） ZINC ION × 12	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPA12_SCHPO
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain I； PDBConstruct 1–119； UniProt 1–119 Author chain U； PDBConstruct 1–119； UniProt 1–119

DNA-directed RNA polymerases I, II, and III subunit RPABC5

OrganismNot specified

UniProt O13877

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 24	DNA-directed RNA polymerase I subunit rpa1 × 2 （P15398） Probable DNA-directed RNA polymerase I subunit RPA2 × 2 （Q9P7X8） DNA-directed RNA polymerases I and III subunit RPAC1 × 2 （O94616） DNA-directed RNA polymerase I subunit rpa14 × 2 （Q9P7P1） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 2 （Q09191） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 2 （P36595） DNA-directed RNA polymerase I subunit rpa43 × 2 （O43036） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 2 （Q92399） DNA-directed RNA polymerase I subunit RPA12 × 2 （O94703） DNA-directed RNA polymerases I and III subunit RPAC2 × 2 （Q09177） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 2 （P48011） ZINC ION × 12	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPAB5_SCHPO
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain J； PDBConstruct 1–71； UniProt 1–71 Author chain V； PDBConstruct 1–71； UniProt 1–71

DNA-directed RNA polymerases I and III subunit RPAC2

OrganismNot specified

UniProt Q09177

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 24	DNA-directed RNA polymerase I subunit rpa1 × 2 （P15398） Probable DNA-directed RNA polymerase I subunit RPA2 × 2 （Q9P7X8） DNA-directed RNA polymerases I and III subunit RPAC1 × 2 （O94616） DNA-directed RNA polymerase I subunit rpa14 × 2 （Q9P7P1） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 2 （Q09191） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 2 （P36595） DNA-directed RNA polymerase I subunit rpa43 × 2 （O43036） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 2 （Q92399） DNA-directed RNA polymerase I subunit RPA12 × 2 （O94703） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 2 （O13877） DNA-directed RNA polymerases I, II, and III subunit RPABC4 × 2 （P48011） ZINC ION × 12	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPAC2_SCHPO
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain K； PDBConstruct 1–125； UniProt 1–125 Author chain W； PDBConstruct 1–125； UniProt 1–125

DNA-directed RNA polymerases I, II, and III subunit RPABC4

OrganismNot specified

UniProt P48011

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 24	DNA-directed RNA polymerase I subunit rpa1 × 2 （P15398） Probable DNA-directed RNA polymerase I subunit RPA2 × 2 （Q9P7X8） DNA-directed RNA polymerases I and III subunit RPAC1 × 2 （O94616） DNA-directed RNA polymerase I subunit rpa14 × 2 （Q9P7P1） DNA-directed RNA polymerases I, II, and III subunit RPABC1 × 2 （Q09191） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 2 （P36595） DNA-directed RNA polymerase I subunit rpa43 × 2 （O43036） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 2 （Q92399） DNA-directed RNA polymerase I subunit RPA12 × 2 （O94703） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 2 （O13877） DNA-directed RNA polymerases I and III subunit RPAC2 × 2 （Q09177） ZINC ION × 12	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPAB4_SCHPO
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain L； PDBConstruct 1–63； UniProt 1–63 Author chain X； PDBConstruct 1–63； UniProt 1–63

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7aod
Deposition date deposition_date	2020-10-14
Structure title title	Schizosaccharomyces pombe RNA polymerase I (dimer)
Keywords keywords	TRANSCRIPTION; TRANSCRIPTION
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7aod__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7aod__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7aod__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	69.07 Å
Rg (electron density)	69.06 Å
Total Rg	69.09 Å
Atom count	59256
Residues	7466
Excluded volume	1058700 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7aod__assembly_1__model_1`	24-meric （24）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (13)

Entity 1 Entity 1 polymer

Description description	DNA-directed RNA polymerase I subunit rpa1
Molecular weight formula_weight	189489.7 kDa
EC 编号 ec_number	2.7.7.6
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,M
Atom count atom_count	59256

MNIAQPVSSEIKSVKFGIYDVDDVEKISVKQIVNPVLLDNLNHPTNGGLYDLALGPYLKNSVCATCHLDERYCPGHFGHIVLPIPAYHPLFFSQMYNLLRSTCLYCHHFKLSKVKVHLFFCRLKLLDYGLLNESEMVENVSLTEAIIKNSNGTPLEDGSDSEDSGLGHDDIAKDAATLMRIRDEFVAKSIADSRQNAHIDAQLTTLLLHERKKVVRAFYHAISSRKQCDNCQSFSPNFRKEGFAKIFEIPLSGKNLQFMEQTGKIRSDVLRDTSKKHHEDEGYDGDSDSSNESEVEGIDLFEEDPNPLKNKSKSPIAHGAKYMTSTEVRNHLRRLFVKENVVLSRLYAHKRGKPASADMFFLQNIAVPPTRFRPASKMGDEVHENIQNELLTRILQSSIQIASLSKDSTVEVNPDEKEGLERRSRAFELLINAFVQLQHDVNSLIDSNRNPSSGGQSRTVPPGIKQILEKKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTLYNFNEMRNAVINGPHKWPGASHIQNEDGTLISLMPLTIEQRTALANQLLTPQSNLISSPYSYSRLINTNKKVYRHVRNGDMLILNRQPTLHKPSMMAHKARILPGEKTIRMHYANCNSYNADFDGDEMNMHFPQSTNARSEAQFIANTDSQYLVPTSGDPLRGLIQDHVVMGVWLTCKDTFYTRDEYQQLLFQALKPDETGMYGRIKTLPPAIQRPGIYWTGKQIISSVLLNLKPSDRPGLNLKSKAKVPGKYWSPDSEEGSVLFDDGELLCGILDKSSFGASAFGLVHSVHELYGPDIAGRLLSVLSRLFTAYAQMRGFTCRMDDLRLDEQGDNWRRQLLENGKSFGLEAASEYVGLSTDSPIALLNANLEEVYRDDEKLQGLDAAMKGKMNGLTSSIINKCIPDGLLTKFPYNHMQTMTVSGAKGSNVNVSQISCLLGQQELEGRRVPLMVSGKSLPSFVPYETSAKSGGFIASRFLTGIAPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLMKHLEGLCVQYDHTVRDSDGSIVQFHYGEDSLDVTKQKHLTQFEFSAKNYKSLIQKYKVKSVLSAVDSETASSYAKKALKKPYKYDPVLDKYPPSRYLGSVSEKFQRAVDEYTQKNPDKLIASKKESKLDDSLLNESKFKALMQLRYQQSLVDPGESVGVLASQSIGEPSTQMTLNTFHFAGFGAKNVTLGIPRLREIIMTASANIQTPTMTLRLNDGVSDKRASAFCKEVNKLVLSEVVRQVRVTEKISGQGSDEQSKTYAIRLDLYSRDEYQDEYGVLQEEIESTFSNRFLKILNRIIKSYLAKSKQRKSGGKDDTVPEVGQALKPLEDIDEAPIEGRAQEALEDEDNDATNEKMVSRSKQHASYEGPDEADKVALRQLKGSNKVEDVNMDEEEDEGFKSDESVSDFKERKLLEKQNTVSISERRELQLKTAKEILSNCKHLDFDYVNGEWATVELVFPINTEKLLMVSLVEKACSETVIHEIPGITRCFSKPPDSALDTVPKVITEGVNLKAIWEFYNEISMNDIYTNDIAAILRIYGVEAARNAIVHEVSSVFGVYGIAVDPRHLSLIADYMTFEGGYKAFNRMGIEYNTSPFAKMSFETTCHFLTEAALRGDVDDLSNPSSRLVVGRVGNFGTGSFDIFTPVVDSPAN

Entity 2 Entity 2 polymer

Description description	Probable DNA-directed RNA polymerase I subunit RPA2
Molecular weight formula_weight	131855.0 kDa
EC 编号 ec_number	2.7.7.6
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,N

MSFQTLERERTFKNPPKDGTSFPDLQKAVKPHVDSFNALTNAGLLNYAVKEIGEKCAFDSITQEEGGALKFGNKISFRVDEVQIAKPMLSSRERSSINRKVYPAEARERLTTYKSRLVLKFSWSVNGGPRQSEMREVGMIPIMVRSNRCHLEGLSPAELIAHKEESEEMGGYFIVNGIEKLIRMLILPKRNHPTAIIRPSFANRGTSYSQYGLSIRCVRPDQSSLTNTLHYLNNGVTMFRFHWRKNEYLIPSMMILKALLETSDKEIFEGIVGKDLGNTFLTDRVELMLRAYKSYGLYSQTETLQYLGSKFRVVLGVAEDLTDVEVGRFLLQKVVLVHLREAKDKFRLLLFMIRKLYALVAGECCADNPDSPQHQEILLGGFLYGQILKEKIEDWLNSIRAQINLDVRRSAPGVDFSDRKYLTRVFSKINNDIGTKLQYFLSTGNLVSNTGLDLQQATGYTVVAEKLNFYRFLSHFRMVHRGAFFAELKTTTVRKLLPEAWGFMCPVHTPDGSPCGLLNHLARKCEIVTHPSDVSQIPSLLLSLGVDPPSVVGHESGWGCVQLDGKIVGWCTYKLAKHVADVLRLMKIEYAVKLRNGTATEPAKVPLDLEIGYVPPSHNGQYPGLYLFSNPARMVRPVKHISTGELDMLGPFEQVYMDIACFPKEIVPKVSTHVEYSPTNVLSIVANMTPFSDFNQSPRNMYQCQMGKQTMGTPGTALRYRTDNKLYRLQTGQTPVVRPKLHNTYGLDHYPNGTNAVVAVISYTGYDMEDAMILNKSAHERGFGYGTVYKGESFDLSQKRRRGEPVVHHFGFAPGSTPRREWLQKLDADGLPFIGIKLEDGDPIVAYYDESTGQNFIETYHGTEPGFVDEVRLLGNDVGDSECQQIHVKLRITRSPIIGDKFSSRHGQKGICSQKWPTVDMPFTESGMQPDIIINPHAFPSRMTIGMFIESLAGKAGACHGLAQDSTPFIYSEQQTAADYFGEQLVKAGYNYHGNEPMYSGITGQEMKADIYIGVVYYQRLRHMVSDKFQVRTTGPIHNLTRQPVKGRKRAGGIRFGEMERDAVIGHGTSFLMQDRLMNCSDYAQSWVCRDCGSIISIMSTISMNGVGSASEVRCRSCAKPALGLEDTSDIWQDGSGKKFVGGTNTTLIALPSVFNYLTAELTAMNIKMMLEVK

Entity 3 Entity 3 polymer

Description description	DNA-directed RNA polymerases I and III subunit RPAC1
Molecular weight formula_weight	39205.5 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,O

MAAVDRSRTEISVLSDRVTDVGSVDFPGYYFDEDNIWDLDKFKKNLKVSITSLDQETMVFEISGIDASIANAFRRILIAEIPTLAFEFVYIINNTSIIQDEVLSHRIGLVPISADPDMFKWFQHPLPGQEATHTDYDTVVFSLNKKCEFNKNAATDEKDPKRLYVNSEVYSGDLIWKPQGRQEERFADNPIRVVNPDIVVAKLRPGQEIDLEAHAILGIGQDHAKFSPVATASYRLLPTIHILSPIEGEDAVKFQKCFPKGVIELEEGPDGKKQARVADVRKDTVSRECLRHPEFADKVQLGRVRDHYLFSVESTGIMKPDVLFIKSIAVLKSKCLAVKSSLQNISSD

Entity 4 Entity 4 polymer

Description description	DNA-directed RNA polymerase I subunit rpa14
Molecular weight formula_weight	17008.4 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,P

MATECPPKMILRKSEKLDKDASSKFLNRYIQTIERFQDEKSGSESVLSQLNRVLMYLKGEEIPLISLNLPVQGPPTEELIIPPEEMLETKEEESLKHAREENDDLHLDKETKKRLKKEKKKAARREKEEARKAKADTTQGVGEKEQS

Entity 5 Entity 5 polymer

Description description	DNA-directed RNA polymerases I, II, and III subunit RPABC1
Molecular weight formula_weight	23954.5 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,Q

MSAEEKNIVRVFRAWKTAHQLVHDRGYGVSQAELDLTLDQFKAMHCGMGRNLDRTTLSFYAKPSNDSNKGTIYIEFAKEPSVGIKEMRTFVHTLGDHNHKTGILIYANSMTPSAAKIIATVTGQFTIETFQESDLIVNITHHELVPKHILLSPDEKKELLDRYKLRETQLPRIQLADPVARYLGLKRGEVVKIVRRSETSGRYNSYRICA

Entity 6 Entity 6 polymer

Description description	DNA-directed RNA polymerases I, II, and III subunit RPABC2
Molecular weight formula_weight	15742.5 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F,R

MSDYEEDEAFGMDGAVMEEEVDELEMIDENGQSQQGVSHPGEPSTTVITEDVASSKTAQSGKAVAKEDRTTTPYMTKYERARILGTRALQISMNAPVLVDLEGETDPLQIAMKELAQKKIPLLVRRYLPDGSYEDWSVAELI

Entity 7 Entity 7 polymer

Description description	DNA-directed RNA polymerase I subunit rpa43
Molecular weight formula_weight	19406.4 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G,S

MPDLSLYKQTVDLYLSIAPGHSRDPLNAIQEHMDSMILSKLPRINGIVLAYDNIRFLEKSAKVMYDSPFSFIWVRVDVLVFSPKKGDCLEGKINLVSPSHIGLLILGIFNASIPRKSIPKDWIFIEPDTTEEQGRWKTNDGNILEPGKDLEFVVDGIQREAGLTMVQGTLANS

Entity 8 Entity 8 polymer

Description description	DNA-directed RNA polymerases I, II, and III subunit RPABC3
Molecular weight formula_weight	14317.3 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H,T

MSESVLLDEIFTVTSVDKQKYQRVSRITAVSGQNDMNLTLDINSQIYPLEKDATFSLQITSNLNSPDLKEAADYIMYGKVYRVEEAKDEKVSVYVSFGGLLMAIEGSHRKLYRLSLDHVYLLLRR

Entity 9 Entity 9 polymer

Description description	DNA-directed RNA polymerase I subunit RPA12
Molecular weight formula_weight	13127.7 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I,U

MSAIGSLIFCSECGNLLESTTAQWTTCDQCQSVYPSEQFANLVVETKSSASAFPSALKLKHSIVQVESQKEEAATIEEKCPKCGNDHMTFHTLQLRSADEGSTVFYECPRCAYKFSTNN

Entity 10 Entity 10 polymer

Description description	DNA-directed RNA polymerases I, II, and III subunit RPABC5
Molecular weight formula_weight	8286.8 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J,V

MIIPIRCFSCGKVIGDKWDTYLTLLQEDNTEGEALDKLGLQRYCCRRMILTHVDLIEKLLCYNPLSKQKNL

Entity 11 Entity 11 polymer

Description description	DNA-directed RNA polymerases I and III subunit RPAC2
Molecular weight formula_weight	13734.5 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K,W

MAAMTDVTDPSSVAMESATEKIIILPGHSADLTSVTFQIQKEDHTLGNSLRYVIMKNPEVEFCGYSIPHPSEAKMNFRIQTAPSTTAVDVLRKGLDDLIDLCDAVTEKFTEQLPRDTSTTMEVDG

Entity 12 Entity 12 polymer

Description description	DNA-directed RNA polymerases I, II, and III subunit RPABC4
Molecular weight formula_weight	7216.5 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L,X

MNHPTSTGGTAFNPPRPATMIYLCADCGARNTIQAKEVIRCRECGHRVMYKMRTKRMVQFEAR

Entity 13 Entity 13 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	12

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	triclinic

Resolution resolution	4.50 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	17102

Schizosaccharomyces pombe RNA polymerase I (dimer)

1. Protein Identity and Related Structures Protein Identity & Related Structures

DNA-directed RNA polymerase I subunit rpa1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Probable DNA-directed RNA polymerase I subunit RPA2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerases I and III subunit RPAC1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerase I subunit rpa14

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerases I, II, and III subunit RPABC1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerases I, II, and III subunit RPABC2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerase I subunit rpa43

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerases I, II, and III subunit RPABC3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerase I subunit RPA12

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerases I, II, and III subunit RPABC5

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer