SAXSdb — 7bbl

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Gem-associated protein 6

Homo sapiens

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 3	Gem-associated protein 7 × 1 （Q9H840） Gem-associated protein 8 × 1 （Q9NWZ8） water × 3	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 3	Gem-associated protein 7 × 1 （Q9H840） Gem-associated protein 8 × 1 （Q9NWZ8） water × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	GEMI6_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–92； UniProt 1–92 Author chain C； PDBConstruct 1–92； UniProt 1–92

Gem-associated protein 7

Homo sapiens

UniProt Q9H840

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 3	Gem-associated protein 6 × 1 （Q8WXD5） Gem-associated protein 8 × 1 （Q9NWZ8） water × 3	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 3	Gem-associated protein 6 × 1 （Q8WXD5） Gem-associated protein 8 × 1 （Q9NWZ8） water × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	GEMI7_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 2–87； UniProt 46–131 Author chain D； PDBConstruct 2–87； UniProt 46–131

Gem-associated protein 8

Homo sapiens

UniProt Q9NWZ8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 3	Gem-associated protein 6 × 1 （Q8WXD5） Gem-associated protein 7 × 1 （Q9H840） water × 3	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 3	Gem-associated protein 6 × 1 （Q8WXD5） Gem-associated protein 7 × 1 （Q9H840） water × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	GEMI8_HUMAN
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain E； PDBConstruct 3–42； UniProt 191–230 Author chain F； PDBConstruct 3–42； UniProt 191–230

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7bbl
Deposition date deposition_date	2020-12-17
Structure title title	Structure of human Gemin6/Gemin7/Gemin8 trimeric complex
Keywords keywords	UsnRNP, Biogenesis, SMN-complex, Gemin8, SPLICING; SPLICING
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7bbl__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7bbl__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7bbl__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	18.82 Å
Rg (electron density)	17.45 Å
Total Rg	18.52 Å
Atom count	1646
Residues	207
Excluded volume	29122 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7bbl__assembly_1__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`7bbl__assembly_2__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	Gem-associated protein 6
Molecular weight formula_weight	10538.0 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,C
Atom count atom_count	3735

MSEWMKKGPLEWQDYIYKEVRVTASEKNEYKGWVLTTDPVSANIVLVNFLEDGSMSVTGIMGHAVQTVETMNEGDHRVREKLMHLFTSGDCK

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 2 Entity 2 polymer

Description description	Gem-associated protein 7
Molecular weight formula_weight	9733.1 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,B

MIAQESLESQEQRARAALRERYLRSLLAMVGHQVSFTLHEGVRVAAHFGATDLDVANFYVSQLQTPIGVQAEALLRCSDIISYTFKP

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 3 Entity 3 polymer

Description description	Gem-associated protein 8
Molecular weight formula_weight	4900.6 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,F

HMERPGERRQAEMKRLYGDSAAKIQAMEAAVQLSFDKHCDRK

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	363

▶

Unit-cell length a length_a	59.880 Å
Unit-cell length b length_b	80.597 Å
Unit-cell length c length_c	82.666 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	P 2 21 21
Space-group number int_tables_number	18
Crystal system crystal_system	—

Resolution resolution	1.521 Å
Low-resolution limit resolution_low	48.494 Å
R factor r_factor	0.2080
R_work r_work	0.2058
R_free r_free	0.2506

Structure of human Gemin6/Gemin7/Gemin8 trimeric complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

Gem-associated protein 6

State in the Current Structure

Other States of the Same Protein in the Database

Gem-associated protein 7

State in the Current Structure

Other States of the Same Protein in the Database

Gem-associated protein 8

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7bbl__assembly_1__model_1

7bbl__assembly_1__model_1 | I(q)

7bbl__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 water

7. Citations (1)

Structure of human Gemin6/Gemin7/Gemin8 trimeric complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

Gem-associated protein 6

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Gem-associated protein 7

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Gem-associated protein 8

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7bbl__assembly_1__model_1

7bbl__assembly_1__model_1 | I(q)

7bbl__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 water

7. Citations (1)