7byd

Crystal structure of SN45 TCR in complex with lipopeptide-bound Mamu-B*05104

Method: X-RAY DIFFRACTION D_max: 146.6 Å Quality: GOOD

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

B protein

Macaca mulatta

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 5 PDB declaration: pentameric（5） Consistent with protein copy count	Chain A； UniProt 22–297	Mutation：R149E,K198E,D244E	Beta-2-microglobulin × 1 （Q6V7J5） GLY-GLY-ALA-ILE × 1 SN45 T cell receptor alpha chain × 1 SN45 T cell receptor beta chain × 1 IOD IODIDE ION × 9 EDO 1,2-ETHANEDIOL × 1 TRS 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL × 1 CA CALCIUM ION × 1 MYR MYRISTIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；pH 6.5；293 K；0.2 M sodium iodide, 0.1 M Bis-Tris-propane pH 6.5 and 20% PEG3350	Resolution 2.80 Å R-free 0.250
2	Protein heterocomplex Heteromer Protein × 5 PDB declaration: pentameric（5） Consistent with protein copy count	Chain F； UniProt 22–297	Mutation：R149E,K198E,D244E	Beta-2-microglobulin × 1 （Q6V7J5） GLY-GLY-ALA-ILE × 1 SN45 T cell receptor alpha chain × 1 SN45 T cell receptor beta chain × 1 IOD IODIDE ION × 10 EDO 1,2-ETHANEDIOL × 3 MYR MYRISTIC ACID × 1 NA SODIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；pH 6.5；293 K；0.2 M sodium iodide, 0.1 M Bis-Tris-propane pH 6.5 and 20% PEG3350	Resolution 2.80 Å R-free 0.250

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 7BYD	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6IWG Crystal structure of rhesus macaque MHC class I molecule Mamu-B*05104 complexed with N-myristoylated 4-mer lipopeptide derived from SIV nef protein Deposited 2018-12-05	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 22–297（276 aa）	Mutation：R128E,K177E,D223E,K264E	NA SODIUM ION × 4 EDO 1,2-ETHANEDIOL × 18 BO3 BORIC ACID × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；277.15 K；100mM MIB, 25% PEG 1500	Resolution 1.80 Å R-free 0.215
6IWH Crystal structure of rhesus macaque MHC class I molecule Mamu-B*05104 complexed with C14-GGGI lipopeptide Deposited 2018-12-05	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 22–297（276 aa）	Mutation：R128E,K177E,D223E,K264E	NA SODIUM ION × 5 EDO 1,2-ETHANEDIOL × 13	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；293.15 K；200mM Sodium fluoride, 100mM Bis-Tris propane, 20% PEG 3350	Resolution 1.95 Å R-free 0.217
6LT6 Crystal structure of rhesus macaque MHC class I molecule Mamu-B*05104 complexed with lysophosphatidylcholine Deposited 2020-01-21	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 22–297（276 aa）	Mutation：R128E, K177E	EKG (2R)-2,3-dihydroxypropyl hexadecanoate × 1 EDO 1,2-ETHANEDIOL × 8 NA SODIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；293.15 K；0.1M Bis-Tris propane, 0.2M Sodium malonate dibasic monohydrate, 20% PEG3350	Resolution 2.15 Å R-free 0.232

3 other PDB entries and 3 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	B2ZHY7_MACMU
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–276； UniProt 22–297 Author chain F； PDBConstruct 1–276； UniProt 22–297

Beta-2-microglobulin

Macaca mulatta

UniProt Q6V7J5

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 5 PDB declaration: pentameric（5） Consistent with protein copy count	Chain B； UniProt 20–119	Not recorded	B protein × 1 （B2ZHY7） GLY-GLY-ALA-ILE × 1 SN45 T cell receptor alpha chain × 1 SN45 T cell receptor beta chain × 1 IOD IODIDE ION × 9 EDO 1,2-ETHANEDIOL × 1 TRS 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL × 1 CA CALCIUM ION × 1 MYR MYRISTIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；pH 6.5；293 K；0.2 M sodium iodide, 0.1 M Bis-Tris-propane pH 6.5 and 20% PEG3350	Resolution 2.80 Å R-free 0.250
2	Protein heterocomplex Heteromer Protein × 5 PDB declaration: pentameric（5） Consistent with protein copy count	Chain G； UniProt 20–119	Not recorded	B protein × 1 （B2ZHY7） GLY-GLY-ALA-ILE × 1 SN45 T cell receptor alpha chain × 1 SN45 T cell receptor beta chain × 1 IOD IODIDE ION × 10 EDO 1,2-ETHANEDIOL × 3 MYR MYRISTIC ACID × 1 NA SODIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；pH 6.5；293 K；0.2 M sodium iodide, 0.1 M Bis-Tris-propane pH 6.5 and 20% PEG3350	Resolution 2.80 Å R-free 0.250

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 7BYD	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
3JTT Cystal structure of Rhesus macaque MHC class I:Mamu-A*02 Deposited 2009-09-14	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain B 21–119（99 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.5；291 K；0.1 M Bis-Tris pH 5.5, 2 M ammonium sulfate , VAPOR DIFFUSION, HANGING DROP, temperature 291K	Resolution 2.80 Å R-free 0.255
3JTT Cystal structure of Rhesus macaque MHC class I:Mamu-A*02 Deposited 2009-09-14	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain E 21–119（99 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.5；291 K；0.1 M Bis-Tris pH 5.5, 2 M ammonium sulfate , VAPOR DIFFUSION, HANGING DROP, temperature 291K	Resolution 2.80 Å R-free 0.255
3JTT Cystal structure of Rhesus macaque MHC class I:Mamu-A*02 Deposited 2009-09-14	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain H 21–119（99 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.5；291 K；0.1 M Bis-Tris pH 5.5, 2 M ammonium sulfate , VAPOR DIFFUSION, HANGING DROP, temperature 291K	Resolution 2.80 Å R-free 0.255
3RWC Crystal structure of rhesus macaque MHC class I molecule Mamu-B*17-IW9 Deposited 2011-05-09	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain B 21–119（99 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.50 Å R-free 0.249
3RWC Crystal structure of rhesus macaque MHC class I molecule Mamu-B*17-IW9 Deposited 2011-05-09	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain E 21–119（99 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.50 Å R-free 0.249
3RWD rhesus macaque MHC class I molecule Mamu-B*17-IW11 Deposited 2011-05-09	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain B 21–119（99 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.60 Å R-free 0.277
3RWD rhesus macaque MHC class I molecule Mamu-B*17-IW11 Deposited 2011-05-09	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain E 21–119（99 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.60 Å R-free 0.277
3RWE rhesus macaque MHC class I molecule Mamu-B*17-FW9 Deposited 2011-05-09	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain B 21–119（99 aa）	Not recorded	PEG DI(HYDROXYETHYL)ETHER × 2	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.40 Å R-free 0.251
3RWF Rhesus macaque MHC class I molecule Mamu-B*17-QW9 Deposited 2011-05-09	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain B 21–119（99 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.60 Å R-free 0.246
3RWG Rhesus macaque MHC class I molecule Mamu-B*17-MW9 Deposited 2011-05-09	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain B 21–119（99 aa）	Not recorded	XPE 3,6,9,12,15,18,21,24,27-NONAOXANONACOSANE-1,29-DIOL × 1 NA SODIUM ION × 1 PEG DI(HYDROXYETHYL)ETHER × 2	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.10 Å R-free 0.237
3RWH Rhesus macaque MHC class I molecule Mamu-B*17-MF8 Deposited 2011-05-09	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain B 21–119（99 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.60 Å R-free 0.272
3RWH Rhesus macaque MHC class I molecule Mamu-B*17-MF8 Deposited 2011-05-09	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain E 21–119（99 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.60 Å R-free 0.272
3RWI Rhesus macaque MHC class I molecule Mamu-B*17-GW10 Deposited 2011-05-09	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain B 21–119（99 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.01 Å R-free 0.210
4ZFZ Crystal structure of rhesus macaque MHC class I molecule Mamu-B*098 complexed with myristoylated 5-mer lipopeptide derived from SIV Nef protein Deposited 2015-04-22	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain B 20–119（100 aa）	Not recorded	ZN ZINC ION × 6 EDO 1,2-ETHANEDIOL × 16 TRS 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL × 1 CL CHLORIDE ION × 1 MYR MYRISTIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.2；293 K；Zinc chloride, Tris-HCl, PEG6000	Resolution 1.76 Å R-free 0.228
4ZFZ Crystal structure of rhesus macaque MHC class I molecule Mamu-B*098 complexed with myristoylated 5-mer lipopeptide derived from SIV Nef protein Deposited 2015-04-22	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain E 20–119（100 aa）	Not recorded	ZN ZINC ION × 5 EDO 1,2-ETHANEDIOL × 15 TRS 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL × 1 MYR MYRISTIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.2；293 K；Zinc chloride, Tris-HCl, PEG6000	Resolution 1.76 Å R-free 0.228
4ZFZ Crystal structure of rhesus macaque MHC class I molecule Mamu-B*098 complexed with myristoylated 5-mer lipopeptide derived from SIV Nef protein Deposited 2015-04-22	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain H 20–119（100 aa）	Not recorded	ZN ZINC ION × 3 EDO 1,2-ETHANEDIOL × 16 CL CHLORIDE ION × 1 MYR MYRISTIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.2；293 K；Zinc chloride, Tris-HCl, PEG6000	Resolution 1.76 Å R-free 0.228
4ZFZ Crystal structure of rhesus macaque MHC class I molecule Mamu-B*098 complexed with myristoylated 5-mer lipopeptide derived from SIV Nef protein Deposited 2015-04-22	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain K 20–119（100 aa）	Not recorded	ZN ZINC ION × 4 EDO 1,2-ETHANEDIOL × 18 CL CHLORIDE ION × 1 MYR MYRISTIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.2；293 K；Zinc chloride, Tris-HCl, PEG6000	Resolution 1.76 Å R-free 0.228
6IWG Crystal structure of rhesus macaque MHC class I molecule Mamu-B*05104 complexed with N-myristoylated 4-mer lipopeptide derived from SIV nef protein Deposited 2018-12-05	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain B 20–119（100 aa）	Not recorded	NA SODIUM ION × 4 EDO 1,2-ETHANEDIOL × 18 BO3 BORIC ACID × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；277.15 K；100mM MIB, 25% PEG 1500	Resolution 1.80 Å R-free 0.215
6IWH Crystal structure of rhesus macaque MHC class I molecule Mamu-B*05104 complexed with C14-GGGI lipopeptide Deposited 2018-12-05	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain B 20–119（100 aa）	Not recorded	NA SODIUM ION × 5 EDO 1,2-ETHANEDIOL × 13	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；293.15 K；200mM Sodium fluoride, 100mM Bis-Tris propane, 20% PEG 3350	Resolution 1.95 Å R-free 0.217
6LAH Crystal structure of rhesus macaque MHC class I molecule Mamu-B*098 complexed with lysophosphatidylcholine Deposited 2019-11-12	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 20–119（100 aa）	Not recorded	ZN ZINC ION × 1 EDO 1,2-ETHANEDIOL × 12 EKG (2R)-2,3-dihydroxypropyl hexadecanoate × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.4；293.15 K；Tris 0.1 M, 2 mM ZnCl2, PEG6000 13%	Resolution 1.87 Å R-free 0.230
6LAH Crystal structure of rhesus macaque MHC class I molecule Mamu-B*098 complexed with lysophosphatidylcholine Deposited 2019-11-12	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 20–119（100 aa）	Not recorded	ZN ZINC ION × 5 EDO 1,2-ETHANEDIOL × 19 EKG (2R)-2,3-dihydroxypropyl hexadecanoate × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.4；293.15 K；Tris 0.1 M, 2 mM ZnCl2, PEG6000 13%	Resolution 1.87 Å R-free 0.230
6LAM Crystal structure of rhesus macaque MHC class I molecule Mamu-B*098 complexed with lysophosphatidylethanolamine Deposited 2019-11-12	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 20–119（100 aa）	Not recorded	ZN ZINC ION × 2 EDO 1,2-ETHANEDIOL × 10 TRS 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL × 1 EKG (2R)-2,3-dihydroxypropyl hexadecanoate × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.15；293.15 K；Tris 0.1 M, 2 mM ZnCl2, PEG6000 13%	Resolution 1.80 Å R-free 0.229
6LAM Crystal structure of rhesus macaque MHC class I molecule Mamu-B*098 complexed with lysophosphatidylethanolamine Deposited 2019-11-12	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 20–119（100 aa）	Not recorded	ZN ZINC ION × 4 EDO 1,2-ETHANEDIOL × 16 TRS 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL × 1 EKG (2R)-2,3-dihydroxypropyl hexadecanoate × 1 CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.15；293.15 K；Tris 0.1 M, 2 mM ZnCl2, PEG6000 13%	Resolution 1.80 Å R-free 0.229
6LB2 Crystal structure of rhesus macaque MHC class I molecule Mamu-B*098 complexed with mono-acyl glycerol Deposited 2019-11-13	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 20–119（100 aa）	Not recorded	ZN ZINC ION × 4 EDO 1,2-ETHANEDIOL × 22 EKG (2R)-2,3-dihydroxypropyl hexadecanoate × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.7；293.15 K；Tris 0.1 M, 2 mM ZnCl2, PEG6000 13%	Resolution 1.69 Å R-free 0.227
6LB2 Crystal structure of rhesus macaque MHC class I molecule Mamu-B*098 complexed with mono-acyl glycerol Deposited 2019-11-13	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 20–119（100 aa）	Not recorded	ZN ZINC ION × 3 EDO 1,2-ETHANEDIOL × 19 EKG (2R)-2,3-dihydroxypropyl hexadecanoate × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.7；293.15 K；Tris 0.1 M, 2 mM ZnCl2, PEG6000 13%	Resolution 1.69 Å R-free 0.227
6LT6 Crystal structure of rhesus macaque MHC class I molecule Mamu-B*05104 complexed with lysophosphatidylcholine Deposited 2020-01-21	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 20–119（100 aa）	Not recorded	EKG (2R)-2,3-dihydroxypropyl hexadecanoate × 1 EDO 1,2-ETHANEDIOL × 8 NA SODIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；293.15 K；0.1M Bis-Tris propane, 0.2M Sodium malonate dibasic monohydrate, 20% PEG3350	Resolution 2.15 Å R-free 0.232

15 other PDB entries and 26 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	B2MG_MACMU
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–100； UniProt 20–119 Author chain G； PDBConstruct 1–100； UniProt 20–119

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

Download Download SAXS (.dat) P(r) (.pr.out) CIF

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7byd
Deposition date deposition_date	2020-04-22
Structure title title	Crystal structure of SN45 TCR in complex with lipopeptide-bound Mamu-B*05104
Keywords keywords	Major histocompatibility complex class 1, T cell receptor, lipopeptide, IMMUNE SYSTEM; IMMUNE SYSTEM
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	43.75 Å
Radius of gyration Rg (electron density) rg_electron	43.29 Å
Forward intensity I(0) i0	579870000.00
Molecular weight molecular_weight	189450.0 kDa
Excluded volume excluded_volume	232750 Å³
Envelope volume envelope_volume	330880 Å³
Hydration-shell volume shell_volume	64225 Å³
Envelope diameter envelope_diameter	152.7 Å
Shell Rg shell_rg	47.54 Å
Envelope Rg envelope_rg	42.62 Å
Shape Rg shape_rg	43.29 Å
Total Rg total_rg	43.47 Å
Total atoms total_atoms	13219
Residues n_residues	1635
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	146.6 Å
Rg (real space) rg_real	43.78 Å
Rg uncertainty (real space) rg_real_error	1.97 Å
I(0) (real space) i0_real	5.7990e+08
I(0) uncertainty (real space) i0_real_error	1.2740e+07
Rg (reciprocal space) rg_reciprocal	43.75 Å
I(0) (reciprocal space) i0_reciprocal	579800000.0000
Solution quality estimate total_estimate	0.8764
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	1
Primary peak position r_peak_primary	52.9 Å
Skewness Skewness skewness	0.369
Kurtosis Kurtosis kurtosis	-0.282
Angular range angular_range	— – 0.1800 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	50870000.0000
Real-space data points n_real_points	37
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.862; Stabil: 0.999; Sysdev: 1.000; Positv: 1.000; Valcen: 0.997; Smooth: 0.809

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (12)

Entity 1 Entity 1 polymer

Description description	B protein
Molecular weight formula_weight	31919.2 kDa
Mutation mutation	R149E,K198E,D244E
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,F
Atom count atom_count	13311

GSHSLRYFGTAVSRPGRGEPRFIYVGYVDDTQFVRFDSDAASPRTEPRAPWVEQEGPEYWEEETRRAKARAQTDRADLRTLRGYYNQSEAGSHTLQWMAGCDLGPNGRLLRGYHQSAYDGKDYIALNEDLRSWIAADMAAQNTQRKWEATRYAERFRAYLEGPCLEWLRRYLENGKETLQHADPPKTHVTHHPVSDHEATLRCWALGFYPAEITLTWQRDGEEQTQDIEFVETRPAGDGTFQKWGAVVVPSGEEQRYTCHVQHKGLPEPLTLRWEP

来源 Source

来源生物 organism	Macaca mulatta
通用名 common_name	Rhesus macaque
NCBI Class编号 ncbi_taxonomy_id	9544
宿主生物 host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Beta-2-microglobulin
Molecular weight formula_weight	11731.2 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,G

AIQRTPKIQVYSRHPPENGKPNFLNCYVSGFHPSDIEVDLLKNGEKMGKVEHSDLSFSKDWSFYLLYYTEFTPNEKDEYACRVNHVTLSGPRTVKWDRDM

来源 Source

来源生物 organism	Macaca mulatta
通用名 common_name	Rhesus macaque
NCBI Class编号 ncbi_taxonomy_id	9544
宿主生物 host_organism	Escherichia coli

Entity 3 Entity 3 polymer

Description description	GLY-GLY-ALA-ILE
Molecular weight formula_weight	316.4 kDa
Source method src_method	syn
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,H

GGAI

Entity 4 Entity 4 polymer

Description description	SN45 T cell receptor alpha chain
Molecular weight formula_weight	21809.4 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,I

AKTTQPISMDSYEGQEVNITCNHNDIATSDYIMWYQQFPNQGPRFIIQGYKANIANEVASLFIPTDRKSSTLSLPRVALSDTAVYYCLVGGGGYVLTFGRGTSLIVHPYIQNPDPAVYQLRGSKSNDTSVCLFTDFDSVMNVSQSKDSDVHITDKCVLDMRSMDFKSNGAVAWSNKSDFACTSAFKDSVIPADTFFPG

来源 Source

来源生物 organism	Macaca mulatta
NCBI Class编号 ncbi_taxonomy_id	9544
宿主生物 host_organism	Escherichia coli

Entity 5 Entity 5 polymer

Description description	SN45 T cell receptor beta chain
Molecular weight formula_weight	28086.6 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,J

DTAVSQTPKYLVRQTGKNESLKCEQNLGHNAMYWYKQDSKKLLKIMFIYNNKEPILNETVPYRFSPKSPDKAHLNLHIKSLELGDSAVYFCASSQDLGAGEVYEQYFGPGTRLTVIEDLKKVFPPKVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALEDSRYCLSSRLRVSATFWHNPRNHFRCQVQFYGLSEDDEWTEDRDKPITQKISAEAWGRA

来源 Source

来源生物 organism	Macaca mulatta
NCBI Class编号 ncbi_taxonomy_id	9544
宿主生物 host_organism	Escherichia coli

Entity 6 Entity 6 non-polymer

Description description	IODIDE ION
Molecular weight formula_weight	126.9 kDa
Source method src_method	syn
Copy count entity_count	19

Entity 7 Entity 7 non-polymer

Description description	1,2-ETHANEDIOL
Molecular weight formula_weight	62.1 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 8 Entity 8 non-polymer

Description description	2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL
Molecular weight formula_weight	122.1 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 9 Entity 9 non-polymer

Description description	CALCIUM ION
Molecular weight formula_weight	40.1 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 10 Entity 10 non-polymer

Description description	MYRISTIC ACID
Molecular weight formula_weight	228.4 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 11 Entity 11 non-polymer

Description description	SODIUM ION
Molecular weight formula_weight	23.0 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 12 Entity 12 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	50

▶

8. Citations (1)

▶

Unit-cell length a length_a	83.937 Å
Unit-cell length b length_b	95.071 Å
Unit-cell length c length_c	123.352 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.89 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	4

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	monoclinic

Resolution resolution	2.800 Å
Low-resolution limit resolution_low	41.963 Å
R factor r_factor	0.1884
R_work r_work	0.1852
R_free r_free	0.2496

fit	/app/data/saxs_computation/by/7byd/7byd.fit
pddf	/app/data/pr_computation/by/7byd/7byd.pr.out
profile	/app/data/saxs_computation/by/7byd/7byd.dat

Crystal structure of SN45 TCR in complex with lipopeptide-bound Mamu-B*05104

1. Protein Identity and Related Structures Protein Identity & Related Structures

B protein

State in the Current Structure

Other States of the Same Protein in the Database

Beta-2-microglobulin

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

6. Entities and Polymers Entities & Polymers (12)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

来源 Source

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

来源 Source

Entity 5 Entity 5 polymer

Polymer Polymer

来源 Source

Entity 6 Entity 6 non-polymer

Entity 7 Entity 7 non-polymer

Entity 8 Entity 8 non-polymer

Entity 9 Entity 9 non-polymer

Entity 10 Entity 10 non-polymer

Entity 11 Entity 11 non-polymer

Entity 12 Entity 12 water

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)