Entity 1 Entity 1
polymer
| Description description | light chain of antibody binding fragment of IgG26A |
| Molecular weight formula_weight | 23387.9 kDa |
| Source method src_method | man |
| Copy count entity_count | 1 |
Polymer Polymer
| Polymer type type | polypeptide(L) |
| Chain IDs strand_id | L |
| Atom count atom_count | 4793 |
DIQMTQSPSSLSASVGDRVTITCRASQDVSWGVAWYQQKPGKAPKLLIYSTASLYSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQYSNFPITFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
Source Source
| Source organism organism | Homo sapiens |
| NCBI taxonomy ID ncbi_taxonomy_id | 9606 |
| Host organism host_organism | Homo sapiens |
Entity 2 Entity 2
polymer
| Description description | heavy chain of antibody binding fragment of IgG26A |
| Molecular weight formula_weight | 24397.4 kDa |
| Source method src_method | man |
| Copy count entity_count | 1 |
Polymer Polymer
| Polymer type type | polypeptide(L) |
| Chain IDs strand_id | H |
EVQLVESGGGLVQPGGSLRLSCAASGFTIKDMAIHWVRQAPGKGLEWVARIWPREGFTYYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARFNGYWNYIMDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKAEPKSCDKTH
Source Source
| Source organism organism | Homo sapiens |
| NCBI taxonomy ID ncbi_taxonomy_id | 9606 |
| Host organism host_organism | Homo sapiens |
Entity 3 Entity 3
polymer
| Description description | Interleukin-1 beta |
| Molecular weight formula_weight | 17810.3 kDa |
| Source method src_method | man |
| Copy count entity_count | 1 |
Polymer Polymer
| Polymer type type | polypeptide(L) |
| Chain IDs strand_id | I |
LGSRAPVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS
Source Source
| Source organism organism | Homo sapiens |
| Common name common_name | Human |
| NCBI taxonomy ID ncbi_taxonomy_id | 9606 |
| Host organism host_organism | Escherichia coli |
Entity 4 Entity 4
water
| Description description | water |
| Molecular weight formula_weight | 18.0 kDa |
| Source method src_method | nat |
| Copy count entity_count | 328 |