SAXSdb — 7cyy

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

L-arabinose isomerase

Geobacillus kaustophilus (strain HTA426)

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Homooligomer	Protein 6	(4S)-2-METHYL-2,4-PENTANEDIOL × 2 MANGANESE (II) ION × 9 D-ribitol × 6 water × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	K0IGW6_9BACL
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 126–284； UniProt 124–282 Author chain B； PDBConstruct 126–284； UniProt 124–282 Author chain C； PDBConstruct 126–284； UniProt 124–282 Author chain D； PDBConstruct 126–284； UniProt 124–282 Author chain E； PDBConstruct 126–284； UniProt 124–282 Author chain F； PDBConstruct 126–284； UniProt 124–282

L-arabinose isomerase

Geobacillus kaustophilus (strain HTA426)

UniProt Q2VMT2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Homooligomer	Protein 6	(4S)-2-METHYL-2,4-PENTANEDIOL × 2 MANGANESE (II) ION × 9 D-ribitol × 6 water × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q2VMT2_ALIAC
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 285–378； UniProt 285–378 Author chain B； PDBConstruct 285–378； UniProt 285–378 Author chain C； PDBConstruct 285–378； UniProt 285–378 Author chain D； PDBConstruct 285–378； UniProt 285–378 Author chain E； PDBConstruct 285–378； UniProt 285–378 Author chain F； PDBConstruct 285–378； UniProt 285–378

L-arabinose isomerase

Geobacillus kaustophilus (strain HTA426)

UniProt Q5KYP7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Homooligomer	Protein 6	(4S)-2-METHYL-2,4-PENTANEDIOL × 2 MANGANESE (II) ION × 9 D-ribitol × 6 water × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ARAA_GEOKA
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 2–125； UniProt 1–124 Author chain A； PDBConstruct 379–497； UniProt 378–496 Author chain B； PDBConstruct 2–125； UniProt 1–124 Author chain B； PDBConstruct 379–497； UniProt 378–496 Author chain C； PDBConstruct 2–125； UniProt 1–124 Author chain C； PDBConstruct 379–497； UniProt 378–496 Author chain D； PDBConstruct 2–125； UniProt 1–124 Author chain D； PDBConstruct 379–497； UniProt 378–496 Author chain E； PDBConstruct 2–125； UniProt 1–124 Author chain E； PDBConstruct 379–497； UniProt 378–496 Author chain F； PDBConstruct 2–125； UniProt 1–124 Author chain F； PDBConstruct 379–497； UniProt 378–496

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7cyy
Deposition date deposition_date	2020-09-05
Structure title title	Crystal structure of Arabinose isomerase from hybrid AI8 with Adonitol
Keywords keywords	hybrid, Arabinose isomerase, ISOMERASE; ISOMERASE
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7cyy__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7cyy__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7cyy__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	42.10 Å
Rg (electron density)	41.30 Å
Total Rg	41.66 Å
Atom count	23529
Residues	2962
Excluded volume	416530 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7cyy__assembly_1__model_1`	hexameric （6）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	L-arabinose isomerase
Molecular weight formula_weight	55947.6 kDa
EC 编号 ec_number	5.3.1.4
Source method src_method	man
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D,E,F
Atom count atom_count	23776

MMLSLRPYEFWFVTGSQHLYGEEALKQVEEHSRIMVNEWNRDSVFPFPFVFKSVVTTPEEIRRVCLEANASEQCAGVVTWMHTFSPAKMWIGGLLELRKPLLHLHTQFNRDIPWDSIDMDFMNLNQSAHGDREFGFMVTRLGMPRKVIVGHWQDAEVARRVRGWAMTAVAAAVSRGLKVARFGDNMRQVAVTEGDKVEAEARFGWSVNGYGVGDLAERVRAVSEAEIDRLIDEYQSLYEFAPGCEKGGPLHDGVREQARIELGLRSFLEEGGFEAFTTTFEDLHGMKQLPGLAVQRLMAEGYGFGGEGDWKTAALVRLMKVMADGKGTSFMEDYTYHFEPGNEMILGAHMLEVCPTIAATRPRIEVHPLSIGGKEDPARLVFDGGEGAAVNASLIDLGHRFRLIVNEVDAVKPEHDMPKLPVARILWKPRPSLRDSAEAWILAGGAHHTCFSFAVTTEQLQDFAEMAGIECVVINEHTSVSSFKNELKWNEVFWRGR

Source Source

Source organism organism	Geobacillus kaustophilus (strain HTA426)
NCBI taxonomy ID ncbi_taxonomy_id	235909
Host organism host_organism	Escherichia coli BL21

Entity 2 Entity 2 non-polymer

Description description	(4S)-2-METHYL-2,4-PENTANEDIOL
Molecular weight formula_weight	118.2 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 3 Entity 3 non-polymer

Description description	MANGANESE (II) ION
Molecular weight formula_weight	54.9 kDa
Source method src_method	syn
Copy count entity_count	9

Entity 4 Entity 4 non-polymer

Description description	D-ribitol
Molecular weight formula_weight	152.1 kDa
Source method src_method	syn
Copy count entity_count	6

Entity 5 Entity 5 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	247

▶

Unit-cell length a length_a	205.582 Å
Unit-cell length b length_b	82.120 Å
Unit-cell length c length_c	192.726 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	117.93 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	24

Space group space_group	C 1 2 1
Space-group number int_tables_number	5
Crystal system crystal_system	—

Resolution resolution	2.600 Å
Low-resolution limit resolution_low	48.180 Å
R factor r_factor	0.1903
R_work r_work	0.1865
R_free r_free	0.2613

Crystal structure of Arabinose isomerase from hybrid AI8 with Adonitol

1. Protein Identity and Related Structures Protein Identity & Related Structures

L-arabinose isomerase

State in the Current Structure

Other States of the Same Protein in the Database

L-arabinose isomerase

State in the Current Structure

Other States of the Same Protein in the Database

L-arabinose isomerase

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7cyy__assembly_1__model_1

7cyy__assembly_1__model_1 | I(q)

7cyy__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 water

7. Citations (1)

Crystal structure of Arabinose isomerase from hybrid AI8 with Adonitol

1. Protein Identity and Related Structures Protein Identity & Related Structures

L-arabinose isomerase

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

L-arabinose isomerase

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

L-arabinose isomerase

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7cyy__assembly_1__model_1

7cyy__assembly_1__model_1 | I(q)

7cyy__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 water

7. Citations (1)