7e97

Oxy-deoxy intermediate of 400 kDa giant hemoglobin at 58% oxygen saturation

Method: X-RAY DIFFRACTION

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Extracellular giant hemoglobin major globin subunit A1

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 24	Extracellular giant hemoglobin major globin subunit A2 × 6 （Q7M413） Extracellular giant hemoglobin major globin subunit B2 × 6 （Q7M418） Giant hemoglobin B1b globin chain × 6 （B1Q3G1） PROTOPORPHYRIN IX CONTAINING FE × 24 OXYGEN MOLECULE × 24 water × 24	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	GLBA1_OLIMA
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–140； UniProt 17–156

Extracellular giant hemoglobin major globin subunit A2

OrganismNot specified

UniProt Q7M413

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 24	Extracellular giant hemoglobin major globin subunit A1 × 6 （Q7M419） Extracellular giant hemoglobin major globin subunit B2 × 6 （Q7M418） Giant hemoglobin B1b globin chain × 6 （B1Q3G1） PROTOPORPHYRIN IX CONTAINING FE × 24 OXYGEN MOLECULE × 24 water × 24	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	GLBA2_OLIMA
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–142； UniProt 17–158

Extracellular giant hemoglobin major globin subunit B2

OrganismNot specified

UniProt Q7M418

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 24	Extracellular giant hemoglobin major globin subunit A1 × 6 （Q7M419） Extracellular giant hemoglobin major globin subunit A2 × 6 （Q7M413） Giant hemoglobin B1b globin chain × 6 （B1Q3G1） PROTOPORPHYRIN IX CONTAINING FE × 24 OXYGEN MOLECULE × 24 water × 24	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	GLBB2_OLIMA
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–147； UniProt 17–163

Giant hemoglobin B1b globin chain

OrganismNot specified

UniProt B1Q3G1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 24	Extracellular giant hemoglobin major globin subunit A1 × 6 （Q7M419） Extracellular giant hemoglobin major globin subunit A2 × 6 （Q7M413） Extracellular giant hemoglobin major globin subunit B2 × 6 （Q7M418） PROTOPORPHYRIN IX CONTAINING FE × 24 OXYGEN MOLECULE × 24 water × 24	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	B1Q3G1_OLIMA
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 1–145； UniProt 1–145

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7e97
Deposition date deposition_date	2021-03-03
Structure title title	Oxy-deoxy intermediate of 400 kDa giant hemoglobin at 58% oxygen saturation
Keywords keywords	allostery, structural change, microspectrometry, crystal processing., OXYGEN TRANSPORT; OXYGEN TRANSPORT
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7e97__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7e97__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7e97__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	46.91 Å
Rg (electron density)	46.08 Å
Total Rg	46.34 Å
Atom count	26658
Residues	3444
Excluded volume	466240 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7e97__assembly_1__model_1`	24-meric （24）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Description description	Extracellular giant hemoglobin major globin subunit A1
Molecular weight formula_weight	15188.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	4460

VCNRLEQILVKTQWAQSYGEAENRAAFSRDLFSELFNIQGSSRALFSGVGVDDMNSAAFTAHCLRVTGALNRLISQLDQQATINADLAHLAGQHASRNLDASNFAAMGQAVMSVVPTHLDCFNQHAWGECYERIASGISG

Entity 2 Entity 2 polymer

Description description	Extracellular giant hemoglobin major globin subunit A2
Molecular weight formula_weight	15327.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

DCTSLNRLLVKRQWAEAYGEGTNRELLGNRIWEDLFANMPDARGLFSRVNGNDIDSSEFQAHSLRVLGGLDMCVASLDDVPVLNALLARLNSQHDSRGIPAAGYPAFVASAISAVRATVGARSFDNDAWNSCMNQIVSGISG

Entity 3 Entity 3 polymer

Description description	Extracellular giant hemoglobin major globin subunit B2
Molecular weight formula_weight	15621.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

SSCCSSEDRANVMHNWDAAWSAAYSDRRVALAQAVFASLFSRDAAAQGLFSGVSADNPDSADFRAHCVRVVNGLDVAINMLNDPAVLNEQLAHLSAQHQARAGVAAAHFDVMAEAFAEVMPQVSSCFSSDSWNRCFARIANGISAGL

Entity 4 Entity 4 polymer

Description description	Giant hemoglobin B1b globin chain
Molecular weight formula_weight	14693.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

ECCSRGDAEVVISEWDQVFNAAMAGSSESAIGVAIFDVFFTSSGVSPSMFPGGGDSSSAEFLAQVSRVISGADIAINSLTNRATCDSLLSHLNAQHKAISGVTGAAVTHLSEAISSVVAQVLPSAHIDAWGYCMAYIAAGIGAGL

Entity 5 Entity 5 non-polymer

Description description	PROTOPORPHYRIN IX CONTAINING FE
Molecular weight formula_weight	616.5 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 6 Entity 6 non-polymer

Description description	OXYGEN MOLECULE
Molecular weight formula_weight	32.0 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 7 Entity 7 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	17

▶

Unit-cell length a length_a	111.042 Å
Unit-cell length b length_b	111.042 Å
Unit-cell length c length_c	272.415 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	120.00 °
Molecules per unit cell Z z_pdb	18

Space group space_group	H 3 2
Space-group number int_tables_number	155
Crystal system crystal_system	trigonal

Resolution resolution	2.700 Å
Low-resolution limit resolution_low	47.400 Å
R factor r_factor	0.2078
R_work r_work	0.2055
R_free r_free	0.2515

Oxy-deoxy intermediate of 400 kDa giant hemoglobin at 58% oxygen saturation

1. Protein Identity and Related Structures Protein Identity & Related Structures

Extracellular giant hemoglobin major globin subunit A1

State in the Current Structure

Other States of the Same Protein in the Database

Extracellular giant hemoglobin major globin subunit A2

State in the Current Structure

Other States of the Same Protein in the Database

Extracellular giant hemoglobin major globin subunit B2

State in the Current Structure

Other States of the Same Protein in the Database

Giant hemoglobin B1b globin chain

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7e97__assembly_1__model_1

7e97__assembly_1__model_1 | I(q)

7e97__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 non-polymer

Entity 7 Entity 7 water

7. Citations (1)

Oxy-deoxy intermediate of 400 kDa giant hemoglobin at 58% oxygen saturation

1. Protein Identity and Related Structures Protein Identity & Related Structures

Extracellular giant hemoglobin major globin subunit A1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Extracellular giant hemoglobin major globin subunit A2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Extracellular giant hemoglobin major globin subunit B2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Giant hemoglobin B1b globin chain

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7e97__assembly_1__model_1

7e97__assembly_1__model_1 | I(q)

7e97__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 non-polymer

Entity 7 Entity 7 water

7. Citations (1)