7eeb

Structure of the CatSpermasome

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Enhanced green fluorescent protein,Cation channel sperm-associated protein 1

Mus musculus

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 14 其他Polymer 16	Cation channel sperm-associated protein 2 × 1 （A2ARP9） Cation channel sperm-associated protein 3 × 1 （Q80W99） Cation channel sperm-associated protein 4 × 1 （Q8BVN3） Cation channel sperm-associated protein subunit beta × 1 （A2RTF1） Cation channel sperm-associated protein subunit gamma 2 × 1 （C6KI89） Cation channel sperm-associated protein subunit delta × 1 （E9Q9F6） Cation channel sperm-associated protein subunit epsilon × 1 （P0DP43） Kazal-like domain-containing protein × 1 （Q3V161） Transmembrane protein 249 × 1 （A0A2R8VHF7） Transmembrane protein 262 × 1 （D3Z338） Unknown × 1 EF-hand calcium-binding domain-containing protein 9 × 1 （Q9DAM2） Cation channel sperm-associated protein subunit zeta × 1 （Q9CQP8） ;beta-D-mannopyranose-(1-2)-beta-D-mannopyranose-(1-3)-[beta-D-mannopyranose-(1-3)-beta-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 1 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 7 beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 5 ;beta-D-mannopyranose-(1-3)-[beta-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 2 ;beta-D-mannopyranose-(1-3)-[beta-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-6)-[beta-D-mannopyranose-(1-3)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 1 SODIUM ION × 2 (3beta,14beta,17beta,25R)-3-[4-methoxy-3-(methoxymethyl)butoxy]spirost-5-en × 3 2-acetamido-2-deoxy-beta-D-glucopyranose × 9	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	C5MKY7_HCMV
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 23–261； UniProt 1–239

Enhanced green fluorescent protein,Cation channel sperm-associated protein 1

Mus musculus

UniProt Q91ZR5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 14 其他Polymer 16	Cation channel sperm-associated protein 2 × 1 （A2ARP9） Cation channel sperm-associated protein 3 × 1 （Q80W99） Cation channel sperm-associated protein 4 × 1 （Q8BVN3） Cation channel sperm-associated protein subunit beta × 1 （A2RTF1） Cation channel sperm-associated protein subunit gamma 2 × 1 （C6KI89） Cation channel sperm-associated protein subunit delta × 1 （E9Q9F6） Cation channel sperm-associated protein subunit epsilon × 1 （P0DP43） Kazal-like domain-containing protein × 1 （Q3V161） Transmembrane protein 249 × 1 （A0A2R8VHF7） Transmembrane protein 262 × 1 （D3Z338） Unknown × 1 EF-hand calcium-binding domain-containing protein 9 × 1 （Q9DAM2） Cation channel sperm-associated protein subunit zeta × 1 （Q9CQP8） ;beta-D-mannopyranose-(1-2)-beta-D-mannopyranose-(1-3)-[beta-D-mannopyranose-(1-3)-beta-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 1 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 7 beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 5 ;beta-D-mannopyranose-(1-3)-[beta-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 2 ;beta-D-mannopyranose-(1-3)-[beta-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-6)-[beta-D-mannopyranose-(1-3)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 1 SODIUM ION × 2 (3beta,14beta,17beta,25R)-3-[4-methoxy-3-(methoxymethyl)butoxy]spirost-5-en × 3 2-acetamido-2-deoxy-beta-D-glucopyranose × 9	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CTSR1_MOUSE
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 270–955； UniProt 1–686

Cation channel sperm-associated protein 2

OrganismNot specified

UniProt A2ARP9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 14 其他Polymer 16	Enhanced green fluorescent protein,Cation channel sperm-associated protein 1 × 1 （C5MKY7,Q91ZR5） Cation channel sperm-associated protein 3 × 1 （Q80W99） Cation channel sperm-associated protein 4 × 1 （Q8BVN3） Cation channel sperm-associated protein subunit beta × 1 （A2RTF1） Cation channel sperm-associated protein subunit gamma 2 × 1 （C6KI89） Cation channel sperm-associated protein subunit delta × 1 （E9Q9F6） Cation channel sperm-associated protein subunit epsilon × 1 （P0DP43） Kazal-like domain-containing protein × 1 （Q3V161） Transmembrane protein 249 × 1 （A0A2R8VHF7） Transmembrane protein 262 × 1 （D3Z338） Unknown × 1 EF-hand calcium-binding domain-containing protein 9 × 1 （Q9DAM2） Cation channel sperm-associated protein subunit zeta × 1 （Q9CQP8） ;beta-D-mannopyranose-(1-2)-beta-D-mannopyranose-(1-3)-[beta-D-mannopyranose-(1-3)-beta-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 1 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 7 beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 5 ;beta-D-mannopyranose-(1-3)-[beta-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 2 ;beta-D-mannopyranose-(1-3)-[beta-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-6)-[beta-D-mannopyranose-(1-3)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 1 SODIUM ION × 2 (3beta,14beta,17beta,25R)-3-[4-methoxy-3-(methoxymethyl)butoxy]spirost-5-en × 3 2-acetamido-2-deoxy-beta-D-glucopyranose × 9	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CTSR2_MOUSE
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–588； UniProt 1–588

Cation channel sperm-associated protein 3

OrganismNot specified

UniProt Q80W99

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 14 其他Polymer 16	Enhanced green fluorescent protein,Cation channel sperm-associated protein 1 × 1 （C5MKY7,Q91ZR5） Cation channel sperm-associated protein 2 × 1 （A2ARP9） Cation channel sperm-associated protein 4 × 1 （Q8BVN3） Cation channel sperm-associated protein subunit beta × 1 （A2RTF1） Cation channel sperm-associated protein subunit gamma 2 × 1 （C6KI89） Cation channel sperm-associated protein subunit delta × 1 （E9Q9F6） Cation channel sperm-associated protein subunit epsilon × 1 （P0DP43） Kazal-like domain-containing protein × 1 （Q3V161） Transmembrane protein 249 × 1 （A0A2R8VHF7） Transmembrane protein 262 × 1 （D3Z338） Unknown × 1 EF-hand calcium-binding domain-containing protein 9 × 1 （Q9DAM2） Cation channel sperm-associated protein subunit zeta × 1 （Q9CQP8） ;beta-D-mannopyranose-(1-2)-beta-D-mannopyranose-(1-3)-[beta-D-mannopyranose-(1-3)-beta-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 1 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 7 beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 5 ;beta-D-mannopyranose-(1-3)-[beta-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 2 ;beta-D-mannopyranose-(1-3)-[beta-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-6)-[beta-D-mannopyranose-(1-3)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 1 SODIUM ION × 2 (3beta,14beta,17beta,25R)-3-[4-methoxy-3-(methoxymethyl)butoxy]spirost-5-en × 3 2-acetamido-2-deoxy-beta-D-glucopyranose × 9	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CTSR3_MOUSE
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–395； UniProt 1–395

Cation channel sperm-associated protein 4

OrganismNot specified

UniProt Q8BVN3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 14 其他Polymer 16	Enhanced green fluorescent protein,Cation channel sperm-associated protein 1 × 1 （C5MKY7,Q91ZR5） Cation channel sperm-associated protein 2 × 1 （A2ARP9） Cation channel sperm-associated protein 3 × 1 （Q80W99） Cation channel sperm-associated protein subunit beta × 1 （A2RTF1） Cation channel sperm-associated protein subunit gamma 2 × 1 （C6KI89） Cation channel sperm-associated protein subunit delta × 1 （E9Q9F6） Cation channel sperm-associated protein subunit epsilon × 1 （P0DP43） Kazal-like domain-containing protein × 1 （Q3V161） Transmembrane protein 249 × 1 （A0A2R8VHF7） Transmembrane protein 262 × 1 （D3Z338） Unknown × 1 EF-hand calcium-binding domain-containing protein 9 × 1 （Q9DAM2） Cation channel sperm-associated protein subunit zeta × 1 （Q9CQP8） ;beta-D-mannopyranose-(1-2)-beta-D-mannopyranose-(1-3)-[beta-D-mannopyranose-(1-3)-beta-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 1 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 7 beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 5 ;beta-D-mannopyranose-(1-3)-[beta-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 2 ;beta-D-mannopyranose-(1-3)-[beta-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-6)-[beta-D-mannopyranose-(1-3)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 1 SODIUM ION × 2 (3beta,14beta,17beta,25R)-3-[4-methoxy-3-(methoxymethyl)butoxy]spirost-5-en × 3 2-acetamido-2-deoxy-beta-D-glucopyranose × 9	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CTSR4_MOUSE
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 1–442； UniProt 1–442

Cation channel sperm-associated protein subunit beta

OrganismNot specified

UniProt A2RTF1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 14 其他Polymer 16	Enhanced green fluorescent protein,Cation channel sperm-associated protein 1 × 1 （C5MKY7,Q91ZR5） Cation channel sperm-associated protein 2 × 1 （A2ARP9） Cation channel sperm-associated protein 3 × 1 （Q80W99） Cation channel sperm-associated protein 4 × 1 （Q8BVN3） Cation channel sperm-associated protein subunit gamma 2 × 1 （C6KI89） Cation channel sperm-associated protein subunit delta × 1 （E9Q9F6） Cation channel sperm-associated protein subunit epsilon × 1 （P0DP43） Kazal-like domain-containing protein × 1 （Q3V161） Transmembrane protein 249 × 1 （A0A2R8VHF7） Transmembrane protein 262 × 1 （D3Z338） Unknown × 1 EF-hand calcium-binding domain-containing protein 9 × 1 （Q9DAM2） Cation channel sperm-associated protein subunit zeta × 1 （Q9CQP8） ;beta-D-mannopyranose-(1-2)-beta-D-mannopyranose-(1-3)-[beta-D-mannopyranose-(1-3)-beta-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 1 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 7 beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 5 ;beta-D-mannopyranose-(1-3)-[beta-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 2 ;beta-D-mannopyranose-(1-3)-[beta-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-6)-[beta-D-mannopyranose-(1-3)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 1 SODIUM ION × 2 (3beta,14beta,17beta,25R)-3-[4-methoxy-3-(methoxymethyl)butoxy]spirost-5-en × 3 2-acetamido-2-deoxy-beta-D-glucopyranose × 9	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CTSRB_MOUSE
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain E； PDBConstruct 1–1109； UniProt 1–1109

Cation channel sperm-associated protein subunit gamma 2

OrganismNot specified

UniProt C6KI89

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 14 其他Polymer 16	Enhanced green fluorescent protein,Cation channel sperm-associated protein 1 × 1 （C5MKY7,Q91ZR5） Cation channel sperm-associated protein 2 × 1 （A2ARP9） Cation channel sperm-associated protein 3 × 1 （Q80W99） Cation channel sperm-associated protein 4 × 1 （Q8BVN3） Cation channel sperm-associated protein subunit beta × 1 （A2RTF1） Cation channel sperm-associated protein subunit delta × 1 （E9Q9F6） Cation channel sperm-associated protein subunit epsilon × 1 （P0DP43） Kazal-like domain-containing protein × 1 （Q3V161） Transmembrane protein 249 × 1 （A0A2R8VHF7） Transmembrane protein 262 × 1 （D3Z338） Unknown × 1 EF-hand calcium-binding domain-containing protein 9 × 1 （Q9DAM2） Cation channel sperm-associated protein subunit zeta × 1 （Q9CQP8） ;beta-D-mannopyranose-(1-2)-beta-D-mannopyranose-(1-3)-[beta-D-mannopyranose-(1-3)-beta-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 1 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 7 beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 5 ;beta-D-mannopyranose-(1-3)-[beta-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 2 ;beta-D-mannopyranose-(1-3)-[beta-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-6)-[beta-D-mannopyranose-(1-3)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 1 SODIUM ION × 2 (3beta,14beta,17beta,25R)-3-[4-methoxy-3-(methoxymethyl)butoxy]spirost-5-en × 3 2-acetamido-2-deoxy-beta-D-glucopyranose × 9	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CTSG2_MOUSE
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain F； PDBConstruct 1–1145； UniProt 1–1145

Cation channel sperm-associated protein subunit delta

OrganismNot specified

UniProt E9Q9F6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 14 其他Polymer 16	Enhanced green fluorescent protein,Cation channel sperm-associated protein 1 × 1 （C5MKY7,Q91ZR5） Cation channel sperm-associated protein 2 × 1 （A2ARP9） Cation channel sperm-associated protein 3 × 1 （Q80W99） Cation channel sperm-associated protein 4 × 1 （Q8BVN3） Cation channel sperm-associated protein subunit beta × 1 （A2RTF1） Cation channel sperm-associated protein subunit gamma 2 × 1 （C6KI89） Cation channel sperm-associated protein subunit epsilon × 1 （P0DP43） Kazal-like domain-containing protein × 1 （Q3V161） Transmembrane protein 249 × 1 （A0A2R8VHF7） Transmembrane protein 262 × 1 （D3Z338） Unknown × 1 EF-hand calcium-binding domain-containing protein 9 × 1 （Q9DAM2） Cation channel sperm-associated protein subunit zeta × 1 （Q9CQP8） ;beta-D-mannopyranose-(1-2)-beta-D-mannopyranose-(1-3)-[beta-D-mannopyranose-(1-3)-beta-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 1 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 7 beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 5 ;beta-D-mannopyranose-(1-3)-[beta-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 2 ;beta-D-mannopyranose-(1-3)-[beta-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-6)-[beta-D-mannopyranose-(1-3)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 1 SODIUM ION × 2 (3beta,14beta,17beta,25R)-3-[4-methoxy-3-(methoxymethyl)butoxy]spirost-5-en × 3 2-acetamido-2-deoxy-beta-D-glucopyranose × 9	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CTSRD_MOUSE
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain G； PDBConstruct 1–805； UniProt 1–805

Cation channel sperm-associated protein subunit epsilon

OrganismNot specified

UniProt P0DP43

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 14 其他Polymer 16	Enhanced green fluorescent protein,Cation channel sperm-associated protein 1 × 1 （C5MKY7,Q91ZR5） Cation channel sperm-associated protein 2 × 1 （A2ARP9） Cation channel sperm-associated protein 3 × 1 （Q80W99） Cation channel sperm-associated protein 4 × 1 （Q8BVN3） Cation channel sperm-associated protein subunit beta × 1 （A2RTF1） Cation channel sperm-associated protein subunit gamma 2 × 1 （C6KI89） Cation channel sperm-associated protein subunit delta × 1 （E9Q9F6） Kazal-like domain-containing protein × 1 （Q3V161） Transmembrane protein 249 × 1 （A0A2R8VHF7） Transmembrane protein 262 × 1 （D3Z338） Unknown × 1 EF-hand calcium-binding domain-containing protein 9 × 1 （Q9DAM2） Cation channel sperm-associated protein subunit zeta × 1 （Q9CQP8） ;beta-D-mannopyranose-(1-2)-beta-D-mannopyranose-(1-3)-[beta-D-mannopyranose-(1-3)-beta-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 1 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 7 beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 5 ;beta-D-mannopyranose-(1-3)-[beta-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 2 ;beta-D-mannopyranose-(1-3)-[beta-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-6)-[beta-D-mannopyranose-(1-3)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 1 SODIUM ION × 2 (3beta,14beta,17beta,25R)-3-[4-methoxy-3-(methoxymethyl)butoxy]spirost-5-en × 3 2-acetamido-2-deoxy-beta-D-glucopyranose × 9	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CTSRE_MOUSE
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain H； PDBConstruct 1–985； UniProt 1–985

Kazal-like domain-containing protein

OrganismNot specified

UniProt Q3V161

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 14 其他Polymer 16	Enhanced green fluorescent protein,Cation channel sperm-associated protein 1 × 1 （C5MKY7,Q91ZR5） Cation channel sperm-associated protein 2 × 1 （A2ARP9） Cation channel sperm-associated protein 3 × 1 （Q80W99） Cation channel sperm-associated protein 4 × 1 （Q8BVN3） Cation channel sperm-associated protein subunit beta × 1 （A2RTF1） Cation channel sperm-associated protein subunit gamma 2 × 1 （C6KI89） Cation channel sperm-associated protein subunit delta × 1 （E9Q9F6） Cation channel sperm-associated protein subunit epsilon × 1 （P0DP43） Transmembrane protein 249 × 1 （A0A2R8VHF7） Transmembrane protein 262 × 1 （D3Z338） Unknown × 1 EF-hand calcium-binding domain-containing protein 9 × 1 （Q9DAM2） Cation channel sperm-associated protein subunit zeta × 1 （Q9CQP8） ;beta-D-mannopyranose-(1-2)-beta-D-mannopyranose-(1-3)-[beta-D-mannopyranose-(1-3)-beta-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 1 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 7 beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 5 ;beta-D-mannopyranose-(1-3)-[beta-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 2 ;beta-D-mannopyranose-(1-3)-[beta-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-6)-[beta-D-mannopyranose-(1-3)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 1 SODIUM ION × 2 (3beta,14beta,17beta,25R)-3-[4-methoxy-3-(methoxymethyl)butoxy]spirost-5-en × 3 2-acetamido-2-deoxy-beta-D-glucopyranose × 9	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q3V161_MOUSE
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain L； PDBConstruct 1–706； UniProt 1–706

Transmembrane protein 249

OrganismNot specified

UniProt A0A2R8VHF7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 14 其他Polymer 16	Enhanced green fluorescent protein,Cation channel sperm-associated protein 1 × 1 （C5MKY7,Q91ZR5） Cation channel sperm-associated protein 2 × 1 （A2ARP9） Cation channel sperm-associated protein 3 × 1 （Q80W99） Cation channel sperm-associated protein 4 × 1 （Q8BVN3） Cation channel sperm-associated protein subunit beta × 1 （A2RTF1） Cation channel sperm-associated protein subunit gamma 2 × 1 （C6KI89） Cation channel sperm-associated protein subunit delta × 1 （E9Q9F6） Cation channel sperm-associated protein subunit epsilon × 1 （P0DP43） Kazal-like domain-containing protein × 1 （Q3V161） Transmembrane protein 262 × 1 （D3Z338） Unknown × 1 EF-hand calcium-binding domain-containing protein 9 × 1 （Q9DAM2） Cation channel sperm-associated protein subunit zeta × 1 （Q9CQP8） ;beta-D-mannopyranose-(1-2)-beta-D-mannopyranose-(1-3)-[beta-D-mannopyranose-(1-3)-beta-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 1 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 7 beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 5 ;beta-D-mannopyranose-(1-3)-[beta-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 2 ;beta-D-mannopyranose-(1-3)-[beta-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-6)-[beta-D-mannopyranose-(1-3)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 1 SODIUM ION × 2 (3beta,14beta,17beta,25R)-3-[4-methoxy-3-(methoxymethyl)butoxy]spirost-5-en × 3 2-acetamido-2-deoxy-beta-D-glucopyranose × 9	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A2R8VHF7_MOUSE
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain J； PDBConstruct 1–171； UniProt 1–171

Transmembrane protein 262

OrganismNot specified

UniProt D3Z338

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 14 其他Polymer 16	Enhanced green fluorescent protein,Cation channel sperm-associated protein 1 × 1 （C5MKY7,Q91ZR5） Cation channel sperm-associated protein 2 × 1 （A2ARP9） Cation channel sperm-associated protein 3 × 1 （Q80W99） Cation channel sperm-associated protein 4 × 1 （Q8BVN3） Cation channel sperm-associated protein subunit beta × 1 （A2RTF1） Cation channel sperm-associated protein subunit gamma 2 × 1 （C6KI89） Cation channel sperm-associated protein subunit delta × 1 （E9Q9F6） Cation channel sperm-associated protein subunit epsilon × 1 （P0DP43） Kazal-like domain-containing protein × 1 （Q3V161） Transmembrane protein 249 × 1 （A0A2R8VHF7） Unknown × 1 EF-hand calcium-binding domain-containing protein 9 × 1 （Q9DAM2） Cation channel sperm-associated protein subunit zeta × 1 （Q9CQP8） ;beta-D-mannopyranose-(1-2)-beta-D-mannopyranose-(1-3)-[beta-D-mannopyranose-(1-3)-beta-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 1 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 7 beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 5 ;beta-D-mannopyranose-(1-3)-[beta-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 2 ;beta-D-mannopyranose-(1-3)-[beta-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-6)-[beta-D-mannopyranose-(1-3)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 1 SODIUM ION × 2 (3beta,14beta,17beta,25R)-3-[4-methoxy-3-(methoxymethyl)butoxy]spirost-5-en × 3 2-acetamido-2-deoxy-beta-D-glucopyranose × 9	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	D3Z338_MOUSE
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain M； PDBConstruct 1–116； UniProt 1–116

EF-hand calcium-binding domain-containing protein 9

OrganismNot specified

UniProt Q9DAM2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 14 其他Polymer 16	Enhanced green fluorescent protein,Cation channel sperm-associated protein 1 × 1 （C5MKY7,Q91ZR5） Cation channel sperm-associated protein 2 × 1 （A2ARP9） Cation channel sperm-associated protein 3 × 1 （Q80W99） Cation channel sperm-associated protein 4 × 1 （Q8BVN3） Cation channel sperm-associated protein subunit beta × 1 （A2RTF1） Cation channel sperm-associated protein subunit gamma 2 × 1 （C6KI89） Cation channel sperm-associated protein subunit delta × 1 （E9Q9F6） Cation channel sperm-associated protein subunit epsilon × 1 （P0DP43） Kazal-like domain-containing protein × 1 （Q3V161） Transmembrane protein 249 × 1 （A0A2R8VHF7） Transmembrane protein 262 × 1 （D3Z338） Unknown × 1 Cation channel sperm-associated protein subunit zeta × 1 （Q9CQP8） ;beta-D-mannopyranose-(1-2)-beta-D-mannopyranose-(1-3)-[beta-D-mannopyranose-(1-3)-beta-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 1 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 7 beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 5 ;beta-D-mannopyranose-(1-3)-[beta-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 2 ;beta-D-mannopyranose-(1-3)-[beta-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-6)-[beta-D-mannopyranose-(1-3)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 1 SODIUM ION × 2 (3beta,14beta,17beta,25R)-3-[4-methoxy-3-(methoxymethyl)butoxy]spirost-5-en × 3 2-acetamido-2-deoxy-beta-D-glucopyranose × 9	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	EFCB9_MOUSE
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain I； PDBConstruct 1–216； UniProt 1–216

Cation channel sperm-associated protein subunit zeta

OrganismNot specified

UniProt Q9CQP8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 14 其他Polymer 16	Enhanced green fluorescent protein,Cation channel sperm-associated protein 1 × 1 （C5MKY7,Q91ZR5） Cation channel sperm-associated protein 2 × 1 （A2ARP9） Cation channel sperm-associated protein 3 × 1 （Q80W99） Cation channel sperm-associated protein 4 × 1 （Q8BVN3） Cation channel sperm-associated protein subunit beta × 1 （A2RTF1） Cation channel sperm-associated protein subunit gamma 2 × 1 （C6KI89） Cation channel sperm-associated protein subunit delta × 1 （E9Q9F6） Cation channel sperm-associated protein subunit epsilon × 1 （P0DP43） Kazal-like domain-containing protein × 1 （Q3V161） Transmembrane protein 249 × 1 （A0A2R8VHF7） Transmembrane protein 262 × 1 （D3Z338） Unknown × 1 EF-hand calcium-binding domain-containing protein 9 × 1 （Q9DAM2） ;beta-D-mannopyranose-(1-2)-beta-D-mannopyranose-(1-3)-[beta-D-mannopyranose-(1-3)-beta-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 1 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 7 beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 5 ;beta-D-mannopyranose-(1-3)-[beta-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 2 ;beta-D-mannopyranose-(1-3)-[beta-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-6)-[beta-D-mannopyranose-(1-3)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 1 SODIUM ION × 2 (3beta,14beta,17beta,25R)-3-[4-methoxy-3-(methoxymethyl)butoxy]spirost-5-en × 3 2-acetamido-2-deoxy-beta-D-glucopyranose × 9	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CTSRZ_MOUSE
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain K； PDBConstruct 1–194； UniProt 1–194

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7eeb
Deposition date deposition_date	2021-03-18
Structure title title	Structure of the CatSpermasome
Keywords keywords	ion channel, membrane protein, calcium channel, protein complex, PROTEIN TRANSPORT; PROTEIN TRANSPORT
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7eeb__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7eeb__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7eeb__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	70.18 Å
Rg (electron density)	69.29 Å
Total Rg	69.15 Å
Atom count	47874
Residues	6003
Excluded volume	861390 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7eeb__assembly_1__model_1`	tetradecameric （14）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (22)

Entity 1 Entity 1 polymer

Description description	Enhanced green fluorescent protein,Cation channel sperm-associated protein 1
Molecular weight formula_weight	109442.8 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	47874

DYKDHDGDYKDHDIDYKDDDDKMVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYKENLYFQGSMDQSSRRDESYHETHPGSLDPSHQSHPHPHPHPTLHRPNQGGVYYDSPQHGMFQQPYQQHGGFHQQNELQHLREFSDSHDNAFSHHSYQQDRAGVSTLPNNISHAYGGSHPLAESQHSGGPQSGPRIDPNHHPHQDDPHRPSEPLSHPSSTGSHQGTTHQQYHERSHHLNPQQNRDHADTISYRSSTRFYRSHAPFSRQERPHLHADHHHEGHHAHSHHGEHPHHKEQRHYHGDHMHHHIHHRSPSASQLSHKSHSTLATSPSHVGSKSTASGARYTFGARSQIFGKAQSRESLRESASLSEGEDHVQKRKKAQRAHKKAHTGNIFQLLWEKISHLLLGLQQMILSLTQSLGFETFIFIVVCLNTVILVAQTFTELEIRGEWYFMVLDSIFLSIYVLEAVLKLIALGLEYFYDPWNNLDFFIMVMAVLDFVLLQINSLSYSFYNHSLFRILKVFKSMRALRAIRVLRRLSILTSLHEVAGTLSGSLPSITAILTLMFTCLFLFSVVLRALFQDSDPKRFQNIFTTLFTLFTMLTLDDWSLIYIDNRAQGAWYIIPILMIYIVIQYFIFLNLVIAVLVDNFQMALLKGLEKVKLEQAARVHEKLLDDSLTDLNKADANAQMTEEALKMQLIEGMFGNMTVKQRVLHFQFLQLVAAVEQHQQKFRSQAYVIDELVDMAFEAGDDDYGK

Source Source

Source organism organism	Mus musculus
Common name common_name	Mouse
NCBI taxonomy ID ncbi_taxonomy_id	10090
Host organism host_organism	Mus musculus

Entity 2 Entity 2 polymer

Description description	Cation channel sperm-associated protein 2
Molecular weight formula_weight	68651.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MAQEQGHFQLLRADAIRSKLIDTFSLIEHLQGLSQAVPRHTLREILDPSYQQKLMSGDQEQLVRFSIKPRRMGHITHSRRLLSRLRVRCSRMPPLSLWAGWVLDSSVFSKFIISLIFLNTFVLMVEIELMESTNTALWPVKLALEVADWFILLSFIVEILLMWLASFSLFWKDAWNVFDFFVTLLSLLPELVVLLGVPAHSVWLQLLRVCRVLRSLKLFARFRQIKVILLALVRALKSMTFLLMLLLIFFYIFAVTGVYFFREYSRSTIEGLEYNMFFSDLLNSLVTVFILFTLDHWYAVLQDIWKVPESSRVFSSIYVILWLLLGSIIFRNIIVAMMVTNFQNIRSELSEEMSHLEVQYKADMFKQQIIQRRQHSESLRGTSLGKVSEDIIETSDASDDDDDDDDDDDDDDDDDDDKSDATESDNEESDSENSESENSESEKIDPEKDYAKKSYPEKSHPEKSYPEKSHPEKSYPEKSHPKKSYDEQAEAEKVKEESKEKAYPVSHSISSHGSTAADTAFLENLDWETLVHENLPGLMDMDQDDRIVWPRDSLFRYFELLEKLQYNLEERKKLQEFAVQALMSFEDK

Entity 3 Entity 3 polymer

Description description	Cation channel sperm-associated protein 3
Molecular weight formula_weight	45533.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

MSQHFHHNPVRVKSGSLFATASEALQARLSKIKRKDKECQAYFRKVIKSTFFQIVMITTVTTNSFLLVLGTNYDIQFEFFRTFEVSELFFVSVYVCEFLMKVYVDPITYWKDGYNILDVIILIILTIPYLLRKIKGNHSAYLHFADGIQSLRILKLISYSRGIRTLIIAVGETVYTVASVLTLLFLLMFVFAILGFCLFGVTDRGDLENWGNLASAFFTLFSLATVDGWTDLQEELDKRKFTVSRAFTILFILLASFIFLNMFVGVMIMHTEDSMKKFERDLTLERNLAIMEEKQIILKRQQEEVNRLMNTQKSGSMNFIDMVEGFKKTLRHTDPMVLDDFSTSLSFIDIYLVTLDNQDVIVSKLQELYCEIVNVLSLMLEDMPKESSSSLSGLS

Entity 4 Entity 4 polymer

Description description	Cation channel sperm-associated protein 4
Molecular weight formula_weight	51179.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

MSEKHKWWQQVENIDITHLGPKRKAYELLGRHEEQVLINRRDVMEKKDAWDVQEFITQMYIKQLLRHPAFQLLLAFLLLSNAITIALRTNSYLGQKHYELFSTIDDIVLTILICEVLLGWLNGFWIFWKDGWNILNFAIVFILFMGFFIKQLDMVAITYPLRVLRLVHVCMAVEPLARIIKVILQSMPDLANVMALILFFMLVFSVFGVTLFGAFVPKHFQNMGVALYTLFICITQDGWLDIYTDFQMDEREYAMEVGGAIYFAVFITLGAFIGLNLFVVVVTTNLEQMMKTGEEEGHLNIKFTETEEDEDWTDELPLVHCTEARKDTSTVPKEPLVGGPLSNLTEKTCDNFCLVLEAIQENLMEYKEIREELNMIVEEVSSIRFNQEQQNVILHKYTSKSATFLSEPPEGANKQDLITALVSREKVSDSNINMVNKHKFSH

Entity 5 Entity 5 polymer

Description description	Cation channel sperm-associated protein subunit beta
Molecular weight formula_weight	126250.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

MESPLIYVMLVLLNVFVFSSGVIHNKGKERTYFSCSGEGILTGLHTIKLFLTMDNLKVRCFFRNENQSPSKEILGLFTSGGLAPNMIITNSTFYGGYYFKLTPFSNRLEWLIDIPRQNITVNTDIAAVEQWMIKITMHEGLNIYDTEGTLLDLVREPILQWNLGRVLTEMEVRDLYPEVNDIKVTKSPCANDVALIGFMMKPSSNGVFIGKTISGFWTYKECIWHDLTEIIYAELKDEHQGLTVIDLVLTNHFLVILTSLGLYVSSDLRYPTTSQIKLSRAEFCGFERVDYIRGNLWYNEKCFANRESFEVDYVTITFNRNRTLSESSSCFFSKEPFLHWLPCVFSTIKNEKSIPRVITFLIDQETDSGIYLFNVQDTKETYVTVAMLKDGKPSPRPKFPSFHFPSTFTLPLGMIFHPRSHFLYVYGSQIWVSMDGGNTFEMLCNLFSHHVTKTSNSFYTSDIVFIVEDGRILTTKAGLTTYSELGILKDAIFTLYYDQLGYIHKLTPENFDAGSKLLGHGNSGSIFGKRPDLGFEAILVPQYISTNEMYFFAHVPLTMPTNIQWKKRFKTIHLGKTIEFSKTGLANIKNVYMHKTEPVGFQTSIHTEIIVPFGIENSKDSPCLLSDLEITYSGKLYYTIKLLSKNPLHELKSTDVEKSVLIPGYSSFLIMNITDKWTASALATMPQAIKSNLKFLTGSWFLYNFGTAGGRKWSISTRQCNYWIQQDSLDFMSLNLVKYIDVGNTIDFQFKIIPKAMSTFPIPPVSMVVGNPGLVEVKTQGVFDLNENYYLDIHVSGRFFQKGSTSIALVLWEGSSKCYAITLLPTIKSSCSYLRTMHHTPGRHIPPEDWISGVHKDSQGFNMIKTLPINYRPPSHMGISIPLTDNFYHADPSKPIPRNQFHKSKETGKYKQCANVTSRAMCNCSEHQKFSHAVAFSDCKEKVHRFKFPVTQYPVVLEIFNERDKISAEPPYLVTMTEVNMRKNWQLKHNEPENVKKMKHYLEPLLKTPVYNPLGLNLTIQGSELFHFKVSVVPGVSFCELSEEFQIYVDEVPLPFPGHALIAVATSVVLGVLIFIAFVFQLRNIHPLKALKKSIRGNPGLTSSTTVSS

Entity 6 Entity 6 polymer

Description description	Cation channel sperm-associated protein subunit gamma 2
Molecular weight formula_weight	131550.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

MVSRPAMSPVSPVWPRKPNLWAFWVLRLVLLLSLKSWAEDALQHCTWLLVLNKFEKVGLHLSKDRFQDHEPIDTVAKVFQKLTDSPIDPSENYLSFPYYLQINFSCPGQNIEELARKGHLMGMKPMVQINYMYSVNFYRWEMENVQILMEAAPMRSTGYCPAEAMCVLNWYTPMPFKNGSVVSSVDIYTNGIGPFVSKKRFYVNMNGFLKRDASGKSLFAIGYESLVLKSSHFRLSKSRPLWYTVNHAPVFILGGFYDEKSILFSDSNFQDYVLLELSIDSCWVGSFYCPILGFSATIHDAIATESTLFIRQNQLVYYFTGTYITLFDKSHGSSRWVRVLPSECIKRLCPVYASGNGSEYVLALTTGKNEGYIHIGTITDGLVSFEMVPDGWSVCEKLPGKNCSIDWATYIADERNLLLLVKIDSGQFYLVNFNTEFKTLNILYKIPEFIPEAKELDFLVLLDTVTYTNTPMTPKGLFFNTLNNMLYIWGNFILQSYNREEFIFLADFPKESTIKYMVNSFKGQMAVVTENEEIWYFLEGGYDVYQVVPSQGWETYHNLQKMQKSSFHSEDESLVSLFFEDGKLFQLVYLFDVGKERLVKRLLPVGTLMEYNLPKPFTVVNQGNYQAISFTHTCPFKEIHLIDVPKKHHASRTESYVALPPLVSESLGFHNNNTLAVYQGLVYYLLWLHSKYDKPYADPVHDPTWRWWQHKTKDKDYFFYLFSNRLAAEGIYINMNAYQKLYNMSGDYGIPDLFFLDKGNWFTITVVLLSHQDTFTSSDSQGPTINVDKKLAIAVTIADPECLSVTVTQDVLLNRNAVINKIKVIDKKRCSEQGMIGRNIKKTSMMLKVLGAPGNCIQRTYLGGIIQGFKVVPIFIGCPPGKRLAFDVSYTIMHSEEINKHYFDCVIKDAEMPCFLFRDLFQPFFLVQDLVTGDSGSFLGSYVLKVVGGGRTLNTIRDYTEEEIFRYNSPLDTTNSLIWKTKVERTTEDKKFYIMSHESPGVEWLCLENSPCYDIIPQSIYPPEFFFKLLVSNRGVDNSTYCDYKLTFIVHIHGLPLSSKRTSFIVMVSTSFFIALVVFYILFCLVWPHIVKAWVSLRWRINNIMASESYYTYASSTAGFSLQSHSFEGPSRAGSKEDNVQAKTA

Entity 7 Entity 7 polymer

Description description	Cation channel sperm-associated protein subunit delta
Molecular weight formula_weight	91186.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

MLVLMLAAAVATMVRAHTLCRVHTVRTGKVFKSNIQLQGDPLFYAFPNTFVLKNVCKADISVYLGQKVFLTIDNFESSLLPLTVPKSLAVGVPSITSAHFVSGSLVLFVISGKGYSYDYYENTWRKLEGISEPVSHISGDVCCFKGSFCLELSNNLFAYLRGGQIPGTNIYFSDNGGFSFQLMNTDKLSHLTGTLGGIFHLHSMSQVGVLMVENNLGTFHYMEYPLNHSMGIAFSYKNLLEVIMKPYQRGFMVLWNQKSILVSSNSGQIVEHVRLIDQKIFTDLDVEHANINIYSVASNAYELAFLVAEDHLYYGSQSYMGTYVIKLPHQPLWSTHTSIYFEDIGILQVLTPVADPHFAAYDFDKCTVNVQSSLMDEKLALQPCNVELLESTMINTMFTIDMNSKLKLSALMIPRKGENPTPLVMVSNPHALGFKANLNEFGNTFDGNSKYKLDIELKQQHHWGNSDFNFTASIKRHAISSVTVDIADKTLSCVDLKPLSTLISVGCDMTKKIVVQNKISACTMGILNPVQLQKNYTYTIEKEAYDPINHNGEAQDDLIVFYEYKDLGCPRLVYYDKPWKPVVELWKNGIVEEIMNAEYVISEINGLVTYSYSLTAATANCRSQPQNWSTFESDIENEEPFLWNRENYVSCHEDNKDNPLLWPNVEYQVLGGQTNNKIIFGQRNGIYTFHLSVVDPYYSYCNLNTIFSVYVHGALPVTKFQPLLTILLMVTTTLLTAWLAYAIPKQLRSEKGQRLLGFCYQILQLCLGVCFCTWLRGKLRQWLRPRRVKDQNRGKVRVAQKHPET

Entity 8 Entity 8 polymer

Description description	Cation channel sperm-associated protein subunit epsilon
Molecular weight formula_weight	113913.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

MPSAGQRKPGSLLALQALQKWLLRGGVGAMLARQVVAALLLWLSCCVSALWRYYINSQDYSIFSTRSSIKLEYEGNSFVSWKIPESCKVENTTSPKTTLHCKRAGIHTIKPIAGNQEVERHLTVDNSYICYLWYFTVVDVYYNLSQIVTIWVYDPESASTEELIWTAKKPSLSSRVLTKQMNTLGQRPFIFTVEKRLTYHPGPLTSEGTWVIHLPMSSDDIAKVIRGNKVAFQDCFIANLYFMLTYPMTIISEPPGYEPLTVPPGSPLMLSWDTCISTFALLATDQETFQTNDSFQTWTRVRAPPGILSDAQRHSLRDVIIFDQGTLFLVDGTVYLRTEDEFTKLDESRGISETGILGFSKRRWCQIRYLYKLASKKSILIAWSKTTVYAGYATFRFVTLTDTAKLKDFLKLPQTDTLEVMSVEYLWHPLEAAVLLSHCSVCTTNTRNIRIVIYSAIFQTWTLQDFELQLPKEAILEFRFLYSAMPDIIMWDQHHVYYSYKNFTVVGTISTPSGETNLSSLSQGSKIHQVLTDRIGNVVVKMENNVMFYIKADITEAVILHTWVNTTAKTVVLFDKSFEVCILYYNENLDEKYQLQTQPYPLILELQSINKDLGDWCPYLAFQHNIHSQFYHMDKGESLTIWSQIVYPENRGLYIVVEHYGSSVMTWTQNLEYEIASGFCTKTMITRFFQTTNYELVDNYYQLQKENTGLMLLQFRPSEFSRTCLTAKPVFEIDVGCDSSKYIMVRGFNKSRCQRRDFSYVIDKELLRESLSDNLKVRYDVAKYGCPLTLELGQMFQPIVELYDENGFIKIVDANFILWEIHGRNDYTFNSTMEQNGCINEAQTWDSMIEENPDIPLDDVWGPQNYRPCFSYAIGKPGDLGQPYEILNYSNKNHIKWPMTYAGMYVYRLKILDPNYSFCNLTTIFAIESLGMIPRSSVYLVAALIFVLMLTFISILVLSYFWYLKIYRQFIIEPLHKRPAKQKKN

Entity 9 Entity 9 polymer

Description description	Kazal-like domain-containing protein
Molecular weight formula_weight	79055.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

MAHVRNKKSDDKKAMVVAKEDTNKSESEGVTKLQTYLKTIPIAKKKFAKLPKRKKSPTSAELLLIDPRYSASKEGPLGLGPIVLPFVQRFNNIDGFMTLYVAAVLIHGALFAVVDMTLNIYQVQFSLTRTEWYLMDFSDYIASFVVAIIIAHFGSKGNRTRWIAASCILMGLESMLFAFPFFTYEIIIPGRQSIELCMEENEKRNIICGNSVPNRSKCIYFHIGGQCIHGIAGMPIYILGITFIFDHIPTSSCGFYLAIGHSAYLIGYLLGMVGGLQNFQPPPKEKTVEIEPAKVYQLLQSGWWKTFLIIAAISFCVSFMMVCFPTSLPGAHKLRLAKRKEPPTIDRRLKDMKIQPHLKGFLHNIWHILKNPLMLTQAICKVSEYLTFNTSLYFLPHHLQTQFLITPGIASLLTGAFVLPGGIIGHFLGGLIVDRLEMTNKNKLKFTLVTTVVSVGLFLLIFFVECQTTTFAGINEDYDGYGQLGNLTADCNEYCDCTTSLYTSICGRDEKEYFSPCFAGCKATKVSQTEKTYYNCSCIKEGLAASDDEGQFIDAIAGTCDSDCLKLPLFFAFYFSATVFSNMCSIPVISIILQSVPANFTSLSLGVTYAIVKFVASVPAPLLFRLSSAIACIYWDNNRCGGKERCWIYNKNILVYEFMGIWMSSQLIIVLLNIYAIQIHDVVVHGEITESKTTVKDVKEQKERKA

Entity 10 Entity 10 polymer

Description description	Transmembrane protein 249
Molecular weight formula_weight	19918.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

MLFIICLVFISCNVLREVKYQETWCFPAYGMVIGLWLMLSSIPQRRLVLNHTRGMYHFSIQGRTVCQGPMHLVYVRLALSSDAYGGRFFQLVLCGHKLEPLVLVQLSERYEQMEFLGRHLARKLNINYFDYLASSYRHVVRHWPLGASFSPGIVQRKTQVYTKSSVNDLDV

Entity 11 Entity 11 polymer

Description description	Transmembrane protein 262
Molecular weight formula_weight	13489.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M

MRWRDRIAVLCFPPGLMLTVAALILFFIHMGVFASDVHNFCVIHNYDHMSFRYTVVLIFSQVISIGWAAMGSLYAEMTGDKFLRCFALTILILNGAMFFNRLCLEFLAINYREERH

Entity 12 Entity 12 polymer

Description description	Unknown
Molecular weight formula_weight	2401.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	N

XXXXXXXXXXXXXXXXXXXXXXXXXXXX

Entity 13 Entity 13 polymer

Description description	EF-hand calcium-binding domain-containing protein 9
Molecular weight formula_weight	26170.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

MKLTPGCFLWYLYMDKIYCLLSLRNVKALMVYFHLLDVHHRNTLNDVLFFHFLQHVTNLNKSQIGMIFDLLDWTAVGEIGFDQFYVLICILLAHQDHLEDHFMYRHSRPVFELLDLDGEMNIGAANFQNYRFLFNIKKQELRDLFHDFDITGDRLLNYKEFKLYTIFCTDKSIDRKKRRKDREAAREREKEKGKDKEKYLHLKKIYSSMLSHRSIL

Entity 14 Entity 14 polymer

Description description	Cation channel sperm-associated protein subunit zeta
Molecular weight formula_weight	22776.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K

MEESVKPVPKHANHRRSSVRSSLYGDVRDLWSTATMSTANVSVSDVCEDFDEEGKSVRNRIRKYSQTISIRDSLNLEPEEIQQQARRELELCHGRSLEHGEDHEESETSLASSTSESLIFSLWKPHRTYWTEQQNRLPLPLMELMETEVLDILKKALITYRSTIGRNHFMTKELQGYIEGIRKRRNKRLYFLDQ

Entity 15 Entity 15 branched

Description description	;beta-D-mannopyranose-(1-2)-beta-D-mannopyranose-(1-3)-[beta-D-mannopyranose-(1-3)-beta-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ;
Molecular weight formula_weight	1235.1 kDa
Source method src_method	man
Copy count entity_count	1

Entity 16 Entity 16 branched

Description description	2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose
Molecular weight formula_weight	424.4 kDa
Source method src_method	man
Copy count entity_count	7

Entity 17 Entity 17 branched

Description description	beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose
Molecular weight formula_weight	586.5 kDa
Source method src_method	man
Copy count entity_count	5

Entity 18 Entity 18 branched

Description description	;beta-D-mannopyranose-(1-3)-[beta-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ;
Molecular weight formula_weight	910.8 kDa
Source method src_method	man
Copy count entity_count	2

Entity 19 Entity 19 branched

Description description	;beta-D-mannopyranose-(1-3)-[beta-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-6)-[beta-D-mannopyranose-(1-3)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ;
Molecular weight formula_weight	1235.1 kDa
Source method src_method	man
Copy count entity_count	1

Entity 20 Entity 20 non-polymer

Description description	SODIUM ION
Molecular weight formula_weight	23.0 kDa
Source method src_method	man
Copy count entity_count	2

Entity 21 Entity 21 non-polymer

Description description	(3beta,14beta,17beta,25R)-3-[4-methoxy-3-(methoxymethyl)butoxy]spirost-5-en
Molecular weight formula_weight	544.8 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 22 Entity 22 non-polymer

Description description	2-acetamido-2-deoxy-beta-D-glucopyranose
Molecular weight formula_weight	221.2 kDa
Source method src_method	syn
Copy count entity_count	9

▼

6. Fold Classification (SCOP + CATH) 1 domains

CATH v4.4 (1 domains)

Domain ID domain_id	7eebI01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	238 — Recoverin; domain 1
Homologous superfamily homologous superfamily	10 — EF-hand

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	2.900 Å
Low-resolution limit resolution_low	— Å
R factor r_factor	—
R_work r_work	—
R_free r_free	—

Resolution resolution	2.90 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	560730

Structure of the CatSpermasome

1. Protein Identity and Related Structures Protein Identity & Related Structures

Enhanced green fluorescent protein,Cation channel sperm-associated protein 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Enhanced green fluorescent protein,Cation channel sperm-associated protein 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cation channel sperm-associated protein 2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cation channel sperm-associated protein 3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cation channel sperm-associated protein 4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cation channel sperm-associated protein subunit beta

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cation channel sperm-associated protein subunit gamma 2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cation channel sperm-associated protein subunit delta

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cation channel sperm-associated protein subunit epsilon

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Kazal-like domain-containing protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer