SAXSdb — 7jr9

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Radial spoke protein 9

Chlamydomonas reinhardtii

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 7	Flagellar radial spoke protein 4 × 1 （Q01656） Flagellar radial spoke protein 6 × 1 （Q01657） Flagellar radial spoke protein 6 × 1 Flagellar radial spoke protein 10 × 1 Radial spoke protein 10 × 1 （Q27YU4）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q27YU5_CHLRE
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–269； UniProt 1–269 Author chain B； PDBConstruct 1–269； UniProt 1–269

Flagellar radial spoke protein 4

Chlamydomonas reinhardtii

UniProt Q01656

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 7	Radial spoke protein 9 × 2 （Q27YU5） Flagellar radial spoke protein 6 × 1 （Q01657） Flagellar radial spoke protein 6 × 1 Flagellar radial spoke protein 10 × 1 Radial spoke protein 10 × 1 （Q27YU4）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RSP4_CHLRE
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain C； PDBConstruct 22–486； UniProt 1–465

Flagellar radial spoke protein 6

Chlamydomonas reinhardtii

UniProt Q01657

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 7	Radial spoke protein 9 × 2 （Q27YU5） Flagellar radial spoke protein 4 × 1 （Q01656） Flagellar radial spoke protein 6 × 1 Flagellar radial spoke protein 10 × 1 Radial spoke protein 10 × 1 （Q27YU4）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RSP6_CHLRE
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain D； PDBConstruct 1–459； UniProt 1–459

Radial spoke protein 10

Chlamydomonas reinhardtii

UniProt Q27YU4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 7	Radial spoke protein 9 × 2 （Q27YU5） Flagellar radial spoke protein 4 × 1 （Q01656） Flagellar radial spoke protein 6 × 1 （Q01657） Flagellar radial spoke protein 6 × 1 Flagellar radial spoke protein 10 × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q27YU4_CHLRE
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain E； PDBConstruct 1–216； UniProt 1–216

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7jr9
Deposition date deposition_date	2020-08-11
Structure title title	Chlamydomonas reinhardtii radial spoke minimal head complex
Keywords keywords	Cilia, Radial spoke, Mechano-regulation, STRUCTURAL PROTEIN; STRUCTURAL PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7jr9__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7jr9__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7jr9__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	37.69 Å
Rg (electron density)	37.75 Å
Total Rg	37.98 Å
Atom count	10021
Residues	1314
Excluded volume	177580 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7jr9__assembly_1__model_1`	heptameric （7）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Description description	Radial spoke protein 9
Molecular weight formula_weight	29572.3 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	10021

MVQLEPNITLVLKHLASCGAVVSAEQQAALDHSIPIKRIEAGLRSLTLWGRLTTLNGKDYLVAEGYNVASSKEGAAVYETKYFYSQDGARWSDLQPVDSETATRCARIKGMLSGDPAKNYELEEKDPNAPEPSPEAEEEVKPLVFQIPELAVLRCRVDAIATATSVIPTDSTILNAASQVVPNRLFAGAAYPEKLESYQHRFSLPGSGVTLSQDLRGTWAVQYDAFKGVAQVRSLLFPGYFFYYAANELTWGSLYVGDGLRNNDLIFML

Source Source

Source organism organism	Chlamydomonas reinhardtii
NCBI taxonomy ID ncbi_taxonomy_id	3055
Host organism host_organism	Spodoptera frugiperda

Entity 2 Entity 2 polymer

Description description	Flagellar radial spoke protein 4
Molecular weight formula_weight	52159.2 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

MGSSHHHHHHGGSAENLYFQGMAAVDSVAQALAYLQVHSPQDGTSMYDHLVKLVSKVLEDQPKNAVDLLETSLLVKKSTFDPKESSPLVPIPVAPDATQTQAAVSIFGDPELPINPATGEPVPADPPNEFEAENMLGAAAVLDCLGVGLGRELGVNIALAAKRIGEDPKLAVRSVRFFGKFLGLYSDYFVFEVAFKKEAAKEAAPAAPAPERVEGEAASSSAPEVPVEEPGKGANKFTYLVCSSLGGPLTRLPDVTPAQVKASRRIKKLLTGRLTSHVSTYPAFPGNEANYLRALIARISAATVVAPSDLFSLNDETGELERAEDWEPPAGREMAAPTAWVHVRPHLKSQGRCEVHKRELPEDADEDEFYNEDELEEGPDLLAALEEDAQLPGEQAAWTPIYSSASEAVKTQAGGLRSLVWPGAVCGGRGSEWTCVYVGWGVKNAPFVPLPPPPVAQEFAWGEVETQELELKPAPPPPEEEAEADE

Source Source

Source organism organism	Chlamydomonas reinhardtii
NCBI taxonomy ID ncbi_taxonomy_id	3055
Host organism host_organism	Spodoptera frugiperda

Entity 3 Entity 3 polymer

Description description	Flagellar radial spoke protein 6
Molecular weight formula_weight	48884.6 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

MAADVGQALAFLQQVKTTQGASIYEGLKAALAKVLEDRPVNAVEALETSVLSTPPAANLSVPLVPAASAAAAAAAVAKASLFGDPEPVLDPESGEPIDPDAPNEFECEDVEGDGDLLDGLGVGLGRQEMYAAMLAVKRLGEDAKRGVSTVRFFGKFFGTQADYYVFETTLQSNPDMPEAPEGTIPLEPYGEGVNAYIYFVSNTLGGPLQQLPYVTPEQIKASRLLRRYLTGRLDAPVSAFPAFPGNEANYLRALIARISAATVCCPRGFFTADDDSAELSANDEWVPLKGREMALPVNWSHRYAHLKGQGRTVTHKRDPPDEEEEPEKNFWTAEEMEAGPPPLATLDTDAPLPAATGDKVPPPAWSPVFASASVTTRNQVAGVRSNRWPGAVCACAGRHFTSMYVGWGIKAGGEWSPCPPPPPVPQWGAPAAGVEGGQQLLLECNDLPPKPAPPEEEDE

Source Source

Source organism organism	Chlamydomonas reinhardtii
NCBI taxonomy ID ncbi_taxonomy_id	3055
Host organism host_organism	Spodoptera frugiperda

Entity 4 Entity 4 polymer

Description description	Flagellar radial spoke protein 6
Molecular weight formula_weight	698.9 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

XXXXXXXX

Source Source

Source organism organism	Chlamydomonas reinhardtii
NCBI taxonomy ID ncbi_taxonomy_id	3055
Host organism host_organism	Spodoptera frugiperda

Entity 5 Entity 5 polymer

Description description	Flagellar radial spoke protein 10
Molecular weight formula_weight	528.6 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

XXXXXX

Source Source

Source organism organism	Chlamydomonas reinhardtii
NCBI taxonomy ID ncbi_taxonomy_id	3055
Host organism host_organism	Spodoptera frugiperda

Entity 6 Entity 6 polymer

Description description	Radial spoke protein 10
Molecular weight formula_weight	23553.9 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

MADDELPPQPVWEGPLDEDGKPHGLGKMEYPPPPMGEDDEEEKPGDKFEGTMEHGVRTGKGTYTWGVSGAVYTGDYVNGKKHGKGKMVYPDKGVYEGDWVEDVMQGQGTYTYPNGDIYQGAFWAGKRHGKGMYHYKGPCCQLVGDWADGGFTYGRWVYADGSMFMGKFGGAAADSKPTAGSYFYSSSSLVQEGHFAKDGSWVGHRDPAVGKEFSVA

Source Source

Source organism organism	Chlamydomonas reinhardtii
NCBI taxonomy ID ncbi_taxonomy_id	3055
Host organism host_organism	Spodoptera frugiperda

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	2.95 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	251088

Chlamydomonas reinhardtii radial spoke minimal head complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

Radial spoke protein 9

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Flagellar radial spoke protein 4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Flagellar radial spoke protein 6

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Radial spoke protein 10

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7jr9__assembly_1__model_1

7jr9__assembly_1__model_1 | I(q)

7jr9__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 polymer

Polymer Polymer

Source Source

Entity 5 Entity 5 polymer

Polymer Polymer

Source Source

Entity 6 Entity 6 polymer

Polymer Polymer

Source Source

7. Citations (1)