7jtk

Radial spoke 1 isolated from Chlamydomonas reinhardtii

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Flagellar radial spoke protein 1

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 39	Flagellar radial spoke protein 2 × 2 （Q6UBQ3） Flagellar radial spoke protein 3 × 2 （A8J2J7） Flagellar radial spoke protein 4 × 2 （A8I550） Flagellar radial spoke protein 5 × 2 （Q27YU7） Flagellar radial spoke protein 6 × 2 （Q01657） Flagellar radial spoke protein 7 × 2 （A0A2K3DL29） Flagellar radial spoke protein 9 × 4 （Q27YU5） Flagellar radial spoke protein 10 × 2 （Q27YU4） Flagellar radial spoke protein 11 × 2 （Q27YU3） Flagellar radial spoke protein 12 × 1 （A8I2U9） Flagellar radial spoke protein 14 × 1 （A8HNV0） Flagellar radial spoke protein 16 × 4 （A8IKR9） Dynein 8 kDa light chain, flagellar outer arm × 4 （Q39580） Unknown protein × 1 Flagellar radial spoke protein 23 × 2 （Q69B19） Cytochrome b5 heme-binding domain-containing protein × 1 （A0A2K3DCN8） Uncharacterized protein × 1 （A0A2K3D359） Predicted protein × 2 （A8JDM3） PHOSPHATE ION × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RSP1_CHLRE
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–814； UniProt 1–814 Author chain B； PDBConstruct 1–814； UniProt 1–814

Flagellar radial spoke protein 2

OrganismNot specified

UniProt Q6UBQ3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 39	Flagellar radial spoke protein 1 × 2 （Q27YU0） Flagellar radial spoke protein 3 × 2 （A8J2J7） Flagellar radial spoke protein 4 × 2 （A8I550） Flagellar radial spoke protein 5 × 2 （Q27YU7） Flagellar radial spoke protein 6 × 2 （Q01657） Flagellar radial spoke protein 7 × 2 （A0A2K3DL29） Flagellar radial spoke protein 9 × 4 （Q27YU5） Flagellar radial spoke protein 10 × 2 （Q27YU4） Flagellar radial spoke protein 11 × 2 （Q27YU3） Flagellar radial spoke protein 12 × 1 （A8I2U9） Flagellar radial spoke protein 14 × 1 （A8HNV0） Flagellar radial spoke protein 16 × 4 （A8IKR9） Dynein 8 kDa light chain, flagellar outer arm × 4 （Q39580） Unknown protein × 1 Flagellar radial spoke protein 23 × 2 （Q69B19） Cytochrome b5 heme-binding domain-containing protein × 1 （A0A2K3DCN8） Uncharacterized protein × 1 （A0A2K3D359） Predicted protein × 2 （A8JDM3） PHOSPHATE ION × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RSP2_CHLRE
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain C； PDBConstruct 1–738； UniProt 1–738 Author chain D； PDBConstruct 1–738； UniProt 1–738

Flagellar radial spoke protein 3

OrganismNot specified

UniProt A8J2J7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 39	Flagellar radial spoke protein 1 × 2 （Q27YU0） Flagellar radial spoke protein 2 × 2 （Q6UBQ3） Flagellar radial spoke protein 4 × 2 （A8I550） Flagellar radial spoke protein 5 × 2 （Q27YU7） Flagellar radial spoke protein 6 × 2 （Q01657） Flagellar radial spoke protein 7 × 2 （A0A2K3DL29） Flagellar radial spoke protein 9 × 4 （Q27YU5） Flagellar radial spoke protein 10 × 2 （Q27YU4） Flagellar radial spoke protein 11 × 2 （Q27YU3） Flagellar radial spoke protein 12 × 1 （A8I2U9） Flagellar radial spoke protein 14 × 1 （A8HNV0） Flagellar radial spoke protein 16 × 4 （A8IKR9） Dynein 8 kDa light chain, flagellar outer arm × 4 （Q39580） Unknown protein × 1 Flagellar radial spoke protein 23 × 2 （Q69B19） Cytochrome b5 heme-binding domain-containing protein × 1 （A0A2K3DCN8） Uncharacterized protein × 1 （A0A2K3D359） Predicted protein × 2 （A8JDM3） PHOSPHATE ION × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A8J2J7_CHLRE
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain E； PDBConstruct 1–516； UniProt 1–516 Author chain F； PDBConstruct 1–516； UniProt 1–516

Flagellar radial spoke protein 4

OrganismNot specified

UniProt A8I550

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 39	Flagellar radial spoke protein 1 × 2 （Q27YU0） Flagellar radial spoke protein 2 × 2 （Q6UBQ3） Flagellar radial spoke protein 3 × 2 （A8J2J7） Flagellar radial spoke protein 5 × 2 （Q27YU7） Flagellar radial spoke protein 6 × 2 （Q01657） Flagellar radial spoke protein 7 × 2 （A0A2K3DL29） Flagellar radial spoke protein 9 × 4 （Q27YU5） Flagellar radial spoke protein 10 × 2 （Q27YU4） Flagellar radial spoke protein 11 × 2 （Q27YU3） Flagellar radial spoke protein 12 × 1 （A8I2U9） Flagellar radial spoke protein 14 × 1 （A8HNV0） Flagellar radial spoke protein 16 × 4 （A8IKR9） Dynein 8 kDa light chain, flagellar outer arm × 4 （Q39580） Unknown protein × 1 Flagellar radial spoke protein 23 × 2 （Q69B19） Cytochrome b5 heme-binding domain-containing protein × 1 （A0A2K3DCN8） Uncharacterized protein × 1 （A0A2K3D359） Predicted protein × 2 （A8JDM3） PHOSPHATE ION × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A8I550_CHLRE
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain G； PDBConstruct 1–465； UniProt 1–465 Author chain H； PDBConstruct 1–465； UniProt 1–465

Flagellar radial spoke protein 5

OrganismNot specified

UniProt Q27YU7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 39	Flagellar radial spoke protein 1 × 2 （Q27YU0） Flagellar radial spoke protein 2 × 2 （Q6UBQ3） Flagellar radial spoke protein 3 × 2 （A8J2J7） Flagellar radial spoke protein 4 × 2 （A8I550） Flagellar radial spoke protein 6 × 2 （Q01657） Flagellar radial spoke protein 7 × 2 （A0A2K3DL29） Flagellar radial spoke protein 9 × 4 （Q27YU5） Flagellar radial spoke protein 10 × 2 （Q27YU4） Flagellar radial spoke protein 11 × 2 （Q27YU3） Flagellar radial spoke protein 12 × 1 （A8I2U9） Flagellar radial spoke protein 14 × 1 （A8HNV0） Flagellar radial spoke protein 16 × 4 （A8IKR9） Dynein 8 kDa light chain, flagellar outer arm × 4 （Q39580） Unknown protein × 1 Flagellar radial spoke protein 23 × 2 （Q69B19） Cytochrome b5 heme-binding domain-containing protein × 1 （A0A2K3DCN8） Uncharacterized protein × 1 （A0A2K3D359） Predicted protein × 2 （A8JDM3） PHOSPHATE ION × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RSP5_CHLRE
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain I； PDBConstruct 1–521； UniProt 1–521 Author chain J； PDBConstruct 1–521； UniProt 1–521

Flagellar radial spoke protein 6

OrganismNot specified

UniProt Q01657

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 39	Flagellar radial spoke protein 1 × 2 （Q27YU0） Flagellar radial spoke protein 2 × 2 （Q6UBQ3） Flagellar radial spoke protein 3 × 2 （A8J2J7） Flagellar radial spoke protein 4 × 2 （A8I550） Flagellar radial spoke protein 5 × 2 （Q27YU7） Flagellar radial spoke protein 7 × 2 （A0A2K3DL29） Flagellar radial spoke protein 9 × 4 （Q27YU5） Flagellar radial spoke protein 10 × 2 （Q27YU4） Flagellar radial spoke protein 11 × 2 （Q27YU3） Flagellar radial spoke protein 12 × 1 （A8I2U9） Flagellar radial spoke protein 14 × 1 （A8HNV0） Flagellar radial spoke protein 16 × 4 （A8IKR9） Dynein 8 kDa light chain, flagellar outer arm × 4 （Q39580） Unknown protein × 1 Flagellar radial spoke protein 23 × 2 （Q69B19） Cytochrome b5 heme-binding domain-containing protein × 1 （A0A2K3DCN8） Uncharacterized protein × 1 （A0A2K3D359） Predicted protein × 2 （A8JDM3） PHOSPHATE ION × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RSP6_CHLRE
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain K； PDBConstruct 1–459； UniProt 1–459 Author chain L； PDBConstruct 1–459； UniProt 1–459

Flagellar radial spoke protein 7

OrganismNot specified

UniProt A0A2K3DL29

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 39	Flagellar radial spoke protein 1 × 2 （Q27YU0） Flagellar radial spoke protein 2 × 2 （Q6UBQ3） Flagellar radial spoke protein 3 × 2 （A8J2J7） Flagellar radial spoke protein 4 × 2 （A8I550） Flagellar radial spoke protein 5 × 2 （Q27YU7） Flagellar radial spoke protein 6 × 2 （Q01657） Flagellar radial spoke protein 9 × 4 （Q27YU5） Flagellar radial spoke protein 10 × 2 （Q27YU4） Flagellar radial spoke protein 11 × 2 （Q27YU3） Flagellar radial spoke protein 12 × 1 （A8I2U9） Flagellar radial spoke protein 14 × 1 （A8HNV0） Flagellar radial spoke protein 16 × 4 （A8IKR9） Dynein 8 kDa light chain, flagellar outer arm × 4 （Q39580） Unknown protein × 1 Flagellar radial spoke protein 23 × 2 （Q69B19） Cytochrome b5 heme-binding domain-containing protein × 1 （A0A2K3DCN8） Uncharacterized protein × 1 （A0A2K3D359） Predicted protein × 2 （A8JDM3） PHOSPHATE ION × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A2K3DL29_CHLRE
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain M； PDBConstruct 1–500； UniProt 1–500 Author chain N； PDBConstruct 1–500； UniProt 1–500

Flagellar radial spoke protein 9

OrganismNot specified

UniProt Q27YU5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 39	Flagellar radial spoke protein 1 × 2 （Q27YU0） Flagellar radial spoke protein 2 × 2 （Q6UBQ3） Flagellar radial spoke protein 3 × 2 （A8J2J7） Flagellar radial spoke protein 4 × 2 （A8I550） Flagellar radial spoke protein 5 × 2 （Q27YU7） Flagellar radial spoke protein 6 × 2 （Q01657） Flagellar radial spoke protein 7 × 2 （A0A2K3DL29） Flagellar radial spoke protein 10 × 2 （Q27YU4） Flagellar radial spoke protein 11 × 2 （Q27YU3） Flagellar radial spoke protein 12 × 1 （A8I2U9） Flagellar radial spoke protein 14 × 1 （A8HNV0） Flagellar radial spoke protein 16 × 4 （A8IKR9） Dynein 8 kDa light chain, flagellar outer arm × 4 （Q39580） Unknown protein × 1 Flagellar radial spoke protein 23 × 2 （Q69B19） Cytochrome b5 heme-binding domain-containing protein × 1 （A0A2K3DCN8） Uncharacterized protein × 1 （A0A2K3D359） Predicted protein × 2 （A8JDM3） PHOSPHATE ION × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q27YU5_CHLRE
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain O； PDBConstruct 1–269； UniProt 1–269 Author chain P； PDBConstruct 1–269； UniProt 1–269 Author chain Q； PDBConstruct 1–269； UniProt 1–269 Author chain R； PDBConstruct 1–269； UniProt 1–269

Flagellar radial spoke protein 10

OrganismNot specified

UniProt Q27YU4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 39	Flagellar radial spoke protein 1 × 2 （Q27YU0） Flagellar radial spoke protein 2 × 2 （Q6UBQ3） Flagellar radial spoke protein 3 × 2 （A8J2J7） Flagellar radial spoke protein 4 × 2 （A8I550） Flagellar radial spoke protein 5 × 2 （Q27YU7） Flagellar radial spoke protein 6 × 2 （Q01657） Flagellar radial spoke protein 7 × 2 （A0A2K3DL29） Flagellar radial spoke protein 9 × 4 （Q27YU5） Flagellar radial spoke protein 11 × 2 （Q27YU3） Flagellar radial spoke protein 12 × 1 （A8I2U9） Flagellar radial spoke protein 14 × 1 （A8HNV0） Flagellar radial spoke protein 16 × 4 （A8IKR9） Dynein 8 kDa light chain, flagellar outer arm × 4 （Q39580） Unknown protein × 1 Flagellar radial spoke protein 23 × 2 （Q69B19） Cytochrome b5 heme-binding domain-containing protein × 1 （A0A2K3DCN8） Uncharacterized protein × 1 （A0A2K3D359） Predicted protein × 2 （A8JDM3） PHOSPHATE ION × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q27YU4_CHLRE
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain S； PDBConstruct 1–216； UniProt 1–216 Author chain T； PDBConstruct 1–216； UniProt 1–216

Flagellar radial spoke protein 11

OrganismNot specified

UniProt Q27YU3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 39	Flagellar radial spoke protein 1 × 2 （Q27YU0） Flagellar radial spoke protein 2 × 2 （Q6UBQ3） Flagellar radial spoke protein 3 × 2 （A8J2J7） Flagellar radial spoke protein 4 × 2 （A8I550） Flagellar radial spoke protein 5 × 2 （Q27YU7） Flagellar radial spoke protein 6 × 2 （Q01657） Flagellar radial spoke protein 7 × 2 （A0A2K3DL29） Flagellar radial spoke protein 9 × 4 （Q27YU5） Flagellar radial spoke protein 10 × 2 （Q27YU4） Flagellar radial spoke protein 12 × 1 （A8I2U9） Flagellar radial spoke protein 14 × 1 （A8HNV0） Flagellar radial spoke protein 16 × 4 （A8IKR9） Dynein 8 kDa light chain, flagellar outer arm × 4 （Q39580） Unknown protein × 1 Flagellar radial spoke protein 23 × 2 （Q69B19） Cytochrome b5 heme-binding domain-containing protein × 1 （A0A2K3DCN8） Uncharacterized protein × 1 （A0A2K3D359） Predicted protein × 2 （A8JDM3） PHOSPHATE ION × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q27YU3_CHLRE
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain U； PDBConstruct 1–204； UniProt 1–204 Author chain V； PDBConstruct 1–204； UniProt 1–204

Flagellar radial spoke protein 12

OrganismNot specified

UniProt A8I2U9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 39	Flagellar radial spoke protein 1 × 2 （Q27YU0） Flagellar radial spoke protein 2 × 2 （Q6UBQ3） Flagellar radial spoke protein 3 × 2 （A8J2J7） Flagellar radial spoke protein 4 × 2 （A8I550） Flagellar radial spoke protein 5 × 2 （Q27YU7） Flagellar radial spoke protein 6 × 2 （Q01657） Flagellar radial spoke protein 7 × 2 （A0A2K3DL29） Flagellar radial spoke protein 9 × 4 （Q27YU5） Flagellar radial spoke protein 10 × 2 （Q27YU4） Flagellar radial spoke protein 11 × 2 （Q27YU3） Flagellar radial spoke protein 14 × 1 （A8HNV0） Flagellar radial spoke protein 16 × 4 （A8IKR9） Dynein 8 kDa light chain, flagellar outer arm × 4 （Q39580） Unknown protein × 1 Flagellar radial spoke protein 23 × 2 （Q69B19） Cytochrome b5 heme-binding domain-containing protein × 1 （A0A2K3DCN8） Uncharacterized protein × 1 （A0A2K3D359） Predicted protein × 2 （A8JDM3） PHOSPHATE ION × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A8I2U9_CHLRE
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain W； PDBConstruct 1–181； UniProt 1–181

Flagellar radial spoke protein 14

OrganismNot specified

UniProt A8HNV0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 39	Flagellar radial spoke protein 1 × 2 （Q27YU0） Flagellar radial spoke protein 2 × 2 （Q6UBQ3） Flagellar radial spoke protein 3 × 2 （A8J2J7） Flagellar radial spoke protein 4 × 2 （A8I550） Flagellar radial spoke protein 5 × 2 （Q27YU7） Flagellar radial spoke protein 6 × 2 （Q01657） Flagellar radial spoke protein 7 × 2 （A0A2K3DL29） Flagellar radial spoke protein 9 × 4 （Q27YU5） Flagellar radial spoke protein 10 × 2 （Q27YU4） Flagellar radial spoke protein 11 × 2 （Q27YU3） Flagellar radial spoke protein 12 × 1 （A8I2U9） Flagellar radial spoke protein 16 × 4 （A8IKR9） Dynein 8 kDa light chain, flagellar outer arm × 4 （Q39580） Unknown protein × 1 Flagellar radial spoke protein 23 × 2 （Q69B19） Cytochrome b5 heme-binding domain-containing protein × 1 （A0A2K3DCN8） Uncharacterized protein × 1 （A0A2K3D359） Predicted protein × 2 （A8JDM3） PHOSPHATE ION × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RSP14_CHLRE
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain X； PDBConstruct 1–387； UniProt 1–387

Flagellar radial spoke protein 16

OrganismNot specified

UniProt A8IKR9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 39	Flagellar radial spoke protein 1 × 2 （Q27YU0） Flagellar radial spoke protein 2 × 2 （Q6UBQ3） Flagellar radial spoke protein 3 × 2 （A8J2J7） Flagellar radial spoke protein 4 × 2 （A8I550） Flagellar radial spoke protein 5 × 2 （Q27YU7） Flagellar radial spoke protein 6 × 2 （Q01657） Flagellar radial spoke protein 7 × 2 （A0A2K3DL29） Flagellar radial spoke protein 9 × 4 （Q27YU5） Flagellar radial spoke protein 10 × 2 （Q27YU4） Flagellar radial spoke protein 11 × 2 （Q27YU3） Flagellar radial spoke protein 12 × 1 （A8I2U9） Flagellar radial spoke protein 14 × 1 （A8HNV0） Dynein 8 kDa light chain, flagellar outer arm × 4 （Q39580） Unknown protein × 1 Flagellar radial spoke protein 23 × 2 （Q69B19） Cytochrome b5 heme-binding domain-containing protein × 1 （A0A2K3DCN8） Uncharacterized protein × 1 （A0A2K3D359） Predicted protein × 2 （A8JDM3） PHOSPHATE ION × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A8IKR9_CHLRE
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain Y； PDBConstruct 1–346； UniProt 1–346 Author chain Z； PDBConstruct 1–346； UniProt 1–346 Author chain y； PDBConstruct 1–346； UniProt 1–346 Author chain z； PDBConstruct 1–346； UniProt 1–346

Dynein 8 kDa light chain, flagellar outer arm

OrganismNot specified

UniProt Q39580

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 39	Flagellar radial spoke protein 1 × 2 （Q27YU0） Flagellar radial spoke protein 2 × 2 （Q6UBQ3） Flagellar radial spoke protein 3 × 2 （A8J2J7） Flagellar radial spoke protein 4 × 2 （A8I550） Flagellar radial spoke protein 5 × 2 （Q27YU7） Flagellar radial spoke protein 6 × 2 （Q01657） Flagellar radial spoke protein 7 × 2 （A0A2K3DL29） Flagellar radial spoke protein 9 × 4 （Q27YU5） Flagellar radial spoke protein 10 × 2 （Q27YU4） Flagellar radial spoke protein 11 × 2 （Q27YU3） Flagellar radial spoke protein 12 × 1 （A8I2U9） Flagellar radial spoke protein 14 × 1 （A8HNV0） Flagellar radial spoke protein 16 × 4 （A8IKR9） Unknown protein × 1 Flagellar radial spoke protein 23 × 2 （Q69B19） Cytochrome b5 heme-binding domain-containing protein × 1 （A0A2K3DCN8） Uncharacterized protein × 1 （A0A2K3D359） Predicted protein × 2 （A8JDM3） PHOSPHATE ION × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	DYL1_CHLRE
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain a； PDBConstruct 1–91； UniProt 1–91 Author chain b； PDBConstruct 1–91； UniProt 1–91 Author chain c； PDBConstruct 1–91； UniProt 1–91 Author chain d； PDBConstruct 1–91； UniProt 1–91

Flagellar radial spoke protein 23

OrganismNot specified

UniProt Q69B19

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 39	Flagellar radial spoke protein 1 × 2 （Q27YU0） Flagellar radial spoke protein 2 × 2 （Q6UBQ3） Flagellar radial spoke protein 3 × 2 （A8J2J7） Flagellar radial spoke protein 4 × 2 （A8I550） Flagellar radial spoke protein 5 × 2 （Q27YU7） Flagellar radial spoke protein 6 × 2 （Q01657） Flagellar radial spoke protein 7 × 2 （A0A2K3DL29） Flagellar radial spoke protein 9 × 4 （Q27YU5） Flagellar radial spoke protein 10 × 2 （Q27YU4） Flagellar radial spoke protein 11 × 2 （Q27YU3） Flagellar radial spoke protein 12 × 1 （A8I2U9） Flagellar radial spoke protein 14 × 1 （A8HNV0） Flagellar radial spoke protein 16 × 4 （A8IKR9） Dynein 8 kDa light chain, flagellar outer arm × 4 （Q39580） Unknown protein × 1 Cytochrome b5 heme-binding domain-containing protein × 1 （A0A2K3DCN8） Uncharacterized protein × 1 （A0A2K3D359） Predicted protein × 2 （A8JDM3） PHOSPHATE ION × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q69B19_CHLRE
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain i； PDBConstruct 1–586； UniProt 1–586 Author chain j； PDBConstruct 1–586； UniProt 1–586

Cytochrome b5 heme-binding domain-containing protein

OrganismNot specified

UniProt A0A2K3DCN8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 39	Flagellar radial spoke protein 1 × 2 （Q27YU0） Flagellar radial spoke protein 2 × 2 （Q6UBQ3） Flagellar radial spoke protein 3 × 2 （A8J2J7） Flagellar radial spoke protein 4 × 2 （A8I550） Flagellar radial spoke protein 5 × 2 （Q27YU7） Flagellar radial spoke protein 6 × 2 （Q01657） Flagellar radial spoke protein 7 × 2 （A0A2K3DL29） Flagellar radial spoke protein 9 × 4 （Q27YU5） Flagellar radial spoke protein 10 × 2 （Q27YU4） Flagellar radial spoke protein 11 × 2 （Q27YU3） Flagellar radial spoke protein 12 × 1 （A8I2U9） Flagellar radial spoke protein 14 × 1 （A8HNV0） Flagellar radial spoke protein 16 × 4 （A8IKR9） Dynein 8 kDa light chain, flagellar outer arm × 4 （Q39580） Unknown protein × 1 Flagellar radial spoke protein 23 × 2 （Q69B19） Uncharacterized protein × 1 （A0A2K3D359） Predicted protein × 2 （A8JDM3） PHOSPHATE ION × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A2K3DCN8_CHLRE
Isoform	—
PDB entities	17
Chains and sequence ranges	Author chain k； PDBConstruct 1–230； UniProt 1–230

Uncharacterized protein

OrganismNot specified

UniProt A0A2K3D359

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 39	Flagellar radial spoke protein 1 × 2 （Q27YU0） Flagellar radial spoke protein 2 × 2 （Q6UBQ3） Flagellar radial spoke protein 3 × 2 （A8J2J7） Flagellar radial spoke protein 4 × 2 （A8I550） Flagellar radial spoke protein 5 × 2 （Q27YU7） Flagellar radial spoke protein 6 × 2 （Q01657） Flagellar radial spoke protein 7 × 2 （A0A2K3DL29） Flagellar radial spoke protein 9 × 4 （Q27YU5） Flagellar radial spoke protein 10 × 2 （Q27YU4） Flagellar radial spoke protein 11 × 2 （Q27YU3） Flagellar radial spoke protein 12 × 1 （A8I2U9） Flagellar radial spoke protein 14 × 1 （A8HNV0） Flagellar radial spoke protein 16 × 4 （A8IKR9） Dynein 8 kDa light chain, flagellar outer arm × 4 （Q39580） Unknown protein × 1 Flagellar radial spoke protein 23 × 2 （Q69B19） Cytochrome b5 heme-binding domain-containing protein × 1 （A0A2K3DCN8） Predicted protein × 2 （A8JDM3） PHOSPHATE ION × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A2K3D359_CHLRE
Isoform	—
PDB entities	18
Chains and sequence ranges	Author chain s； PDBConstruct 1–682； UniProt 1–682

Predicted protein

OrganismNot specified

UniProt A8JDM3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 39	Flagellar radial spoke protein 1 × 2 （Q27YU0） Flagellar radial spoke protein 2 × 2 （Q6UBQ3） Flagellar radial spoke protein 3 × 2 （A8J2J7） Flagellar radial spoke protein 4 × 2 （A8I550） Flagellar radial spoke protein 5 × 2 （Q27YU7） Flagellar radial spoke protein 6 × 2 （Q01657） Flagellar radial spoke protein 7 × 2 （A0A2K3DL29） Flagellar radial spoke protein 9 × 4 （Q27YU5） Flagellar radial spoke protein 10 × 2 （Q27YU4） Flagellar radial spoke protein 11 × 2 （Q27YU3） Flagellar radial spoke protein 12 × 1 （A8I2U9） Flagellar radial spoke protein 14 × 1 （A8HNV0） Flagellar radial spoke protein 16 × 4 （A8IKR9） Dynein 8 kDa light chain, flagellar outer arm × 4 （Q39580） Unknown protein × 1 Flagellar radial spoke protein 23 × 2 （Q69B19） Cytochrome b5 heme-binding domain-containing protein × 1 （A0A2K3DCN8） Uncharacterized protein × 1 （A0A2K3D359） PHOSPHATE ION × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A8JDM3_CHLRE
Isoform	—
PDB entities	19
Chains and sequence ranges	Author chain u； PDBConstruct 1–70； UniProt 1–70 Author chain v； PDBConstruct 1–70； UniProt 1–70

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7jtk
Deposition date deposition_date	2020-08-17
Structure title title	Radial spoke 1 isolated from Chlamydomonas reinhardtii
Keywords keywords	cilia, native, complex, mechanoregulation, STRUCTURAL PROTEIN; STRUCTURAL PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7jtk__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7jtk__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7jtk__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	0.00 Å
Rg (electron density)	110.80 Å
Total Rg	110.60 Å
Atom count	72807
Residues	9516
Excluded volume	1293900 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7jtk__assembly_1__model_1`	39-meric （39）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (20)

Entity 1 Entity 1 polymer

Description description	Flagellar radial spoke protein 1
Molecular weight formula_weight	87873.4 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	72807

MALGPFVLPFRGDQYSFGINFKSSPEEKLNFDLSCVAFDVKGQLHDTLHARKPTALDGALVKGFEKQALPEETVQVEGDDVIYMFPKKFERQVEVLLFVASAPSIPGKKHDLDSSSKLEFAVSYSDVGGQAFNQSFDLKPLAAQGGVSSIIVAVMYLQAEGGWTLRSVGDCHPFDSPGLIVPELKQTILNLRDHHGVQLDAADAIQAIDPAERVPVTRQFQDQSLDEASAGRAAEPAPVKKLRIDLSWTFWPPPPPTEEGEEPPEEPALEYNLVMYNKDGEEVQSISTGNREATGARAGRPEPEEDEEEEKEEEKEEPEEGEEGEEGEGGEPKEPPPPPPAPKVDPYEFKERDVIYLDVPDLPAEVRSMVLLVTNYDEENGFTRVRTVRCRLVDVSNGEAPLPGSKAAVAAAAAAAEQGLAAPPNPERVLADYGVLSKYEDDKATTQVALMKLYKEYADSAFNVFRGAGVDNVAAFIGQEPDTIINQLKAYLEATKKQKAAEAAAAAAAEESGEEITADPKPHVWRFRALGLNFGGDSLEAIEHDLKNLFAFDGDLAPGAARDSDTSRSSFPNGDTYFGSYADDVKHGPGLYAFATGAGYAGEYAGGKRHGRGVMVFPDGGTYVGEFVADKFEGQGQYRYPDGSVYTGSWAAGQKHGPGVYWDTARGCLRGEWKKGLLVGKGTYEQPALRFEGEFVRGMPAGTATYTLTGHRTLDMPCFAAQHIQAEEGPTLALPCAYGIPPGSGDEPQLDEEGQPIEDTDKPPLPAHPKYEGLTFTAEQLPGAAPDTVFPPEEGKPVPITAVPAFSVSTGLVA

Entity 2 Entity 2 polymer

Description description	Flagellar radial spoke protein 2
Molecular weight formula_weight	77445.3 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,D

MAPTQAGHDTAYLKETVGEALARGCAAAISAQPNDPVEYLGLWLLKYVKNAEVEGNFYRERQQDLQKKKDRLVKEAQSEQAAKSVALTRKEAADALALVTAEPRELLEAAVKLVKQHTAAGAAYAAVVAEPEEPDWVAPEDDEAAAVETEDEAAGGAALAEGEEPPPEPEPEPEAAPEDGEGDAPAPKIPRPVDYSKKYFAYVAASAGQEHVLEADLYRPAPPPEDADEDFKPEPLPYSFRVLDEKLPMLYVPNVAAEERVKFFRKFPKIGSYQACGVALPASGEFKALLAADTLFPEGSGQPLSADDRDFVWEVSQSLSRALEAVQARAAEALAATSAAEAVEELKAKVAELREQAAAEAAAAAPPPPAEGEEGEGEAPPAEEEPPAEEEAEEEEEEAEEGAEEGAEEGEEGEEAPPKPKKKKKVFNPIPGLQAAIEKLTAAAEAATEADARAQAAVALEKQALDEVVALASSHSDATLSSLRNMLSVPQGTYHVVKALLHLLGRPAASFSTWKRAHSHFSPRLFEDMAAYDATAERDMAVWGRVRSCYKAAPAAKKLDAEMPNTLFGSVALMYIKQVRRVARKAVLQRELAAKLAKAQQDLADKQAALVEAERVKAEREAEEARLAAEAEAAAAAEAEAAARAAAEAEAAAAAEAAAEAAAEAAAAAAEAAAEAGEGEAVAEREAAPAEAEAAPAEGEAAPPAEGEGEAQPAQEGSNSSSSSSDSSSSEESKAAAE

Entity 3 Entity 3 polymer

Description description	Flagellar radial spoke protein 3
Molecular weight formula_weight	56856.7 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,F

MVQAKAQQQLYTHAAEPKAVQQRRAKYREDETTQTLPTANIMFDRRVVRGNTYAARILPADATQTQTKGPSPASTKKRTTRTLPPRTPEAVDGRRHIDIQTDVYLEELTDTVPEADTSTQTDAFLDRPPTPLFVPQKTGTDAITQIENGDLFDFDFEVEPILEVLVGKVLEQGLMEVLEEEELAAMRAHQEHFEQIRNAELVATQRMEAAERRKLEEKERRMQQERERVERERVVRQKVAASAFARGYLSGIVNTVFDRLVSSGYIYDPVMREVETAFMPWLKEQAIGYLARGVVARRVVDKLVEDAAAALAANRSTLADKAASTAATVDAWAERQAKMEAELQGKELEAVRRRPTFVLRELKPAVASADAVEAAAAELTAQAEEAANAKWEADKAEAAEKARAEAEAAAEEQKALLEELAATAAAEAEERGEEPPAEPPSLPDGVEPVDVEAEVAKAVEAVPKPPVKEVTDIDILSYMMDKGAITKDAIIQALAVHALGDKAYTNHPAFAEAEGA

Entity 4 Entity 4 polymer

Description description	Flagellar radial spoke protein 4
Molecular weight formula_weight	49843.8 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G,H

MAAVDSVAQALAYLQVHSPQDGTSMYDHLVKLVSKVLEDQPKNAVDLLETSLLVKKSTFDPKESSPLVPIPVAPDATQTQAAVSIFGDPELPINPATGEPVPADPPNEFEAENMLGAAAVLDCLGVGLGRELGVNIALAAKRIGEDPKLAVRSVRFFGKFLGLYSDYFVFEVAFKKEAAKEAAPAAPAPERVEGEAASSSAPEVPVEEPGKGANKFTYLVCSSLGGPLTRLPDVTPAQVKASRRIKKLLTGRLTSHVSTYPAFPGNEANYLRALIARISAATVVAPSDLFSLNDETGELERAEDWEPPAGREMAAPTAWVHVRPHLKSQGRCEVHKRELPEDADEDEFYNEDELEEGPDLLAALEEDAQLPGEQAAWTPIYSSASEAVKTQAGGLRSLVWPGAVCGGRGSEWTCVYVGWGVKNAPFVPLPPPPVAQEFAWGEVETQELELKPAPPPPEEEAEADE

Entity 5 Entity 5 polymer

Description description	Flagellar radial spoke protein 5
Molecular weight formula_weight	55403.6 kDa
EC 编号 ec_number	1.-.-.-
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I,J

MSEPGEEPVAAPAGPAPDPVLNELYGSERPAVELLPGVPLSPIVNSCWLPADAKAMLAESWIPVPPEDAGEEAGPPPPAFEAAAPEYNELVRRLAKTAPFRKWNELTIQAKQLEQEVAGLKGPDAEAKQAELENVKVQIADAEAAVAEVKQSFSDDPLSLTGWMQALTDLADGGMTTFEVSGQGWPYCSLRQLFGEMPSAAPPAGFFDGVERVLGTFKRRYEKERGPGSVQLMLKLAPNVFSDAWSTGGAPAAVAAVEAYVERARANVFGPDGGVTPEGVPEPLDLVQLVWWDFAAADPLPVLKALQRMATDQLQVDEDSGEVSVSEPKKIRGIGLVDFPADRLKAAIQAGVPITCVQVEHSVLVRSAQPVLDLCAKYGIKVLARGGTLGGLLSAKYLGAPPPDPVRGDADLDSVPGCLDAVNNVGGWARLQAALAVIKGIADKHGVKPETVALRWQIDAGCFPLVTTRWSSRVWRQFGYEGWSSFEVSGGRPGVDGPLFQVESFLDVEDVRALAGLAAVH

Entity 6 Entity 6 polymer

Description description	Flagellar radial spoke protein 6
Molecular weight formula_weight	48884.6 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K,L

MAADVGQALAFLQQVKTTQGASIYEGLKAALAKVLEDRPVNAVEALETSVLSTPPAANLSVPLVPAASAAAAAAAVAKASLFGDPEPVLDPESGEPIDPDAPNEFECEDVEGDGDLLDGLGVGLGRQEMYAAMLAVKRLGEDAKRGVSTVRFFGKFFGTQADYYVFETTLQSNPDMPEAPEGTIPLEPYGEGVNAYIYFVSNTLGGPLQQLPYVTPEQIKASRLLRRYLTGRLDAPVSAFPAFPGNEANYLRALIARISAATVCCPRGFFTADDDSAELSANDEWVPLKGREMALPVNWSHRYAHLKGQGRTVTHKRDPPDEEEEPEKNFWTAEEMEAGPPPLATLDTDAPLPAATGDKVPPPAWSPVFASASVTTRNQVAGVRSNRWPGAVCACAGRHFTSMYVGWGIKAGGEWSPCPPPPPVPQWGAPAAGVEGGQQLLLECNDLPPKPAPPEEEDE

Entity 7 Entity 7 polymer

Description description	Flagellar radial spoke protein 7
Molecular weight formula_weight	54781.9 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M,N

MSSTYQKPITIPGDFPAILKAFTREILRAQPSNIYEFGARYFSGLQGQAEPEGLGRAAPVEPASTSHAATSKATDVEETAVMFDIAALTPAELEPILMKLFIEADADRSGFLDRHEFTAVLRNANLKLSDRQIRQILAEADENDDDVIQYKEFLPIMVDILQSIKAKEQAKAMMHGVETMVRTEVETMLLHGLPQEELQALMLKVFKKADADGSGQLNRHEFKEALKAAELGLTRKDINLILSHIDVDRDGLVSYEEFIPVCFQVLVERFKDEIVVNDILGNADELQQMLLGAFRDADPDNTGLLSQRQVKSIFKELSYKALGLTTLQMVSLISQAPTTPDGMVQYIQFVPQAASIIRSMYDVETMKGRMHAIKAVAEAGGIAALGALDLDQLRGVLEQAFQRVDTEGAGQLTLPQVTQVLDGLNSLAPDANLALSDQHMKAMFAAIDADESGTVDWTELVNFICDALEHIEREAYVANMRDGGAGGAGEAEASPGDEEA

Entity 8 Entity 8 polymer

Description description	Flagellar radial spoke protein 9
Molecular weight formula_weight	29572.3 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	O,P,Q,R

MVQLEPNITLVLKHLASCGAVVSAEQQAALDHSIPIKRIEAGLRSLTLWGRLTTLNGKDYLVAEGYNVASSKEGAAVYETKYFYSQDGARWSDLQPVDSETATRCARIKGMLSGDPAKNYELEEKDPNAPEPSPEAEEEVKPLVFQIPELAVLRCRVDAIATATSVIPTDSTILNAASQVVPNRLFAGAAYPEKLESYQHRFSLPGSGVTLSQDLRGTWAVQYDAFKGVAQVRSLLFPGYFFYYAANELTWGSLYVGDGLRNNDLIFML

Entity 9 Entity 9 polymer

Description description	Flagellar radial spoke protein 10
Molecular weight formula_weight	23553.9 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	S,T

MADDELPPQPVWEGPLDEDGKPHGLGKMEYPPPPMGEDDEEEKPGDKFEGTMEHGVRTGKGTYTWGVSGAVYTGDYVNGKKHGKGKMVYPDKGVYEGDWVEDVMQGQGTYTYPNGDIYQGAFWAGKRHGKGMYHYKGPCCQLVGDWADGGFTYGRWVYADGSMFMGKFGGAAADSKPTAGSYFYSSSSLVQEGHFAKDGSWVGHRDPAVGKEFSVA

Entity 10 Entity 10 polymer

Description description	Flagellar radial spoke protein 11
Molecular weight formula_weight	21504.6 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	U,V

MDVEPIFCAEQIVIPHNLADILKAYTKEVIRRQPTDLIAFSAKYFTNLANVASGVSNSSAPAKEQLRQVYTRGGSGGATLTESQVTGLCQQAGIADAVVAKVMEVGAFTPAAVDLSKFVFLCLAMSCEDFNRVCMGVFDVFSDNGSLPAQDLLTLIAHLGPDMDPEVTPAFLDAVAAELPAGGGAVTYMELCEAPSLKPKLGLS

Entity 11 Entity 11 polymer

Description description	Flagellar radial spoke protein 12
Molecular weight formula_weight	19632.3 kDa
EC 编号 ec_number	5.2.1.8
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	W

MDFESNGAMMEYCKSTGRTYCAFSIQQSSKLLGTVVLELFTDIAPATCANFIKYIKDGYQGTPLHRIVPNGWVQGGDIVDGSGKGDPGFVLPDETYSVKHDAPGVLGMATGGQPHTANTQFYISLSPLPFLDGKRVAFGRVLNKQSLENLLALQTLPTFQNERPVPDVVIASCHVIYNPNS

Entity 12 Entity 12 polymer

Description description	Flagellar radial spoke protein 14
Molecular weight formula_weight	40597.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	X

MDSQARIQANLRHIQAFEAKPNPKALPETAVTRGFEKVAFPKLVRELTCDNAVVRKKSLLAARELLSSPVNHVQCVAAGATPAIVALLQDQTDDETRYYAAGTLKLLAAKEVGARDLAQHSGLDALAAALEDPSEGVRDEAYGALIEAARFDSTRRALEACGSGAVLPRLMELALLEAQGGAAGRAQQGLVLLFTCTQARHNAGILSQLVDVAQAIPHLAGLLKPELPMPVRHAAAELLGALATREDAKIQAVQVGAVPLLLLAASPSVPVPFATSAVAALGAITIRREGKYAALESPGGLAGLVSVLDPCHEQLCINAMTAVSNVAEAPEARAILVASGAGPKLQHIFETATVEVVKRAAAQAIRQCRFKHLPYEVLPGAPPINEE

Entity 13 Entity 13 polymer

Description description	Flagellar radial spoke protein 16
Molecular weight formula_weight	39052.7 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Y,Z,y,z

MTRGLDYYEVMGLTRSANDIDIRRAYRRLALKYHPDINKDGAAGDEFLRICEAYEVLCDPKTKGFYDLYGEDALKDGISDGNGGLKGPMYRFNPEESPKAVFERFFGTANPYEALEALSNQFESMTSEEAPARGKNKVYPLELTLEEIFHGCLKKVAHKRKVLLFSGEYVEEERQLTVDVKPGLPTGTRFVFEGEGNKTPKKEPGPVVFVLKPKPHPRFVRRGSDLVHKVTLPLHHALIGTTLDIRTLDDRDLKVPISDIMRPGSSLTVPGEGMPLPATPSARGNLVIEIDLLFPTHLTETQKMLLRSAFFLPPPTEQNEETKKALRDYEAAFKHDLKGWATVFKR

Entity 14 Entity 14 polymer

Description description	Dynein 8 kDa light chain, flagellar outer arm
Molecular weight formula_weight	10336.8 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	a,b,c,d

MASGSSKAVIKNADMSEEMQADAVDCATQALEKYNIEKDIAAYIKKEFDRKHNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG

Entity 15 Entity 15 polymer

Description description	Unknown protein
Molecular weight formula_weight	2911.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	e

XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

Entity 16 Entity 16 polymer

Description description	Flagellar radial spoke protein 23
Molecular weight formula_weight	61422.2 kDa
EC 编号 ec_number	2.7.4.6
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	i,j

MAELEKTFALIKPDAVRAGKAQEIMQLIELNGFTIIAKQKLQLTRARAEEFYGEHKGKEFFPKLVNFMTSGPIWALVLAKPGAILAWRALMGPTNVFKARAEQPKCLRALYGTDGTQNATHGSDSPISAAREIKFFFPTLSGDPTIYAEPTAAAEYITKRIQPALAKALAALAREKPSADKFEAITFVAGYLLQNNPNKPKVLMPDEWDPALMGDDEDDEADFINARLAAPTGNDGATKAEFDAMVEAAKADTGGAAPAQEFVYPDSKPTTPVVPAPPAPGSKPPSASGARPQSARPTSARPPSASAAPPAPLAPVPPPASSSRPASGSGRPPSATARPPSATPPPPPPAVELEEADDPAQLDEAATKVQAAFRGYQARKEVAVMRSEAQPGEAAAEPEQEAELQPEAEPEPQPEGEQEPQPQASASSSFLPDGVTEEMAAEAATRVQAHMRGHLARKQVAAIKAQQAAPAVAESSEALAEPEPQPEAEAEPQPQASVSSSFLPDGVTEEMAAEAATLVQAHMRGHLARKQVAAIKAQQAAPAVAESSEAQAEAEQTEAEAEPQPDAEAEAGAAEGEAEPEPEAAE

Entity 17 Entity 17 polymer

Description description	Cytochrome b5 heme-binding domain-containing protein
Molecular weight formula_weight	26609.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	k

MAPPRGPLRRYYTPYEVAMHNTPDDCWVSFLGGVYNLTDLIKANQGALAAPLIAAAGQDLTHWFDPTTKDPKRHICPATHIERFYTPMGRFIHVPPPEPMCNWDTSFGLPWWRDAKKYQIGLLSARTRVIRVRNVLTDQEDQIEVPCEEKLVEIRERYLELNAHAKSYTWKALVRDPNGDTHVFQELDLNLTLEENGVPDETPVFEDHHVPTDYFIPVLHVYWNDDLTVA

Entity 18 Entity 18 polymer

Description description	Uncharacterized protein
Molecular weight formula_weight	75037.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	s

MSDPEAEQGEQGYEESPEEPGPGSEAPSPSRIDNGLDTIIDIDPQTQHAEEGSNTAYESEQPDVISSYTGGQQEEDGEQAGNGAIDETTEEAAGEADDGGKASGFAVEVDAGTDAAAEGDLEPEPEPERPASASGEPQPTASTSRPASGAAARPASARPTSARPGSAAPRQPSASGGSRPGSGHPVNLAPDSVGLAQQQQQKSQIEVGAQAYEARGSSRPQSGGDAYGQAEEASAAAAAGRPSTSQSGSRPPPSREGVAVVPSIPEDQPLAVPIHIERYIAPGLKAIEVEVAQGPGMPHRLVRVLLDYTQCDAKPYLGGFRNKRTGAVYHHGATQTPRAPKYSEADRKLSRETQTVKIKQHSQQTVREQATQMARPGVLLDNDYDKEVTPGRYQTADERDEIVLRSTLRIQRWVRGWLGRKRAAYLRGKKMEREAFLRDQEARAQSEAEEHRRREIQRRMHPRTAADFEVLYNELEAWRLQETRKIKEAGLAKEQEQQVLQQLLHKETKLLQTIDRLKINANQENKEARIQHTLNEMSKPKKFALRNGGKVDVHTPFTTRAKELQQLYNGLNLPLLTVDERLDVLLHVKWTVKEFDCDLTRELVDLIDREADLLNRGRNPKMLEGLRKRISSLFLNFIETPEFNPEAVRFQIVPMDFEAYLYEQVGKATAKAGTSVGTRTLS

Entity 19 Entity 19 polymer

Description description	Predicted protein
Molecular weight formula_weight	8111.2 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	u,v

MSSQYSESRPLHGSAAQTPLYEKMRDYAHSNKVQELLQKMTADLFIERPADPVTWMIKWLSEEQKRSGTA

Entity 20 Entity 20 non-polymer

Description description	PHOSPHATE ION
Molecular weight formula_weight	95.0 kDa
Source method src_method	syn
Copy count entity_count	4

▼

6. Fold Classification (SCOP + CATH) 3 domains

CATH v4.4 (3 domains)

Domain ID domain_id	7jtkU01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	890 — cAMP-dependent Protein Kinase, Chain A
Homologous superfamily homologous superfamily	10 — cAMP-dependent protein kinase regulatory subunit, dimerization-anchoring domain

Domain ID domain_id	7jtki01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	141 — Nucleoside diphosphate kinase-like domain

Domain ID domain_id	7jtkj01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	141 — Nucleoside diphosphate kinase-like domain

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.20 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	221836

Radial spoke 1 isolated from Chlamydomonas reinhardtii

1. Protein Identity and Related Structures Protein Identity & Related Structures

Flagellar radial spoke protein 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Flagellar radial spoke protein 2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Flagellar radial spoke protein 3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Flagellar radial spoke protein 4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Flagellar radial spoke protein 5

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Flagellar radial spoke protein 6

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Flagellar radial spoke protein 7

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Flagellar radial spoke protein 9

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Flagellar radial spoke protein 10

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Flagellar radial spoke protein 11

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer