7jrj

Chlamydomonas reinhardtii radial spoke head and neck (recombinant)

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Radial spoke protein 10

Chlamydomonas reinhardtii

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 15	Flagellar radial spoke protein 1 × 1 （Q27YU0） Nucleoside diphosphate kinase 6 × 1 （Q69B19） Flagellar radial spoke protein 2 × 1 （Q6UBQ3） unknown protein × 1 Flagellar radial spoke protein 3 × 1 （P12759） Flagellar radial spoke protein 5 × 1 （Q27YU7） Radial spoke protein 9 × 2 （Q27YU5） Flagellar radial spoke protein 4 × 1 （Q01656） Flagellar radial spoke protein 6 × 1 （Q01657） Flagellar radial spoke protein 6 × 1 Flagellar radial spoke protein 10 × 1 Flagellar radial spoke protein 1 × 1 Flagellar radial spoke protein 2 × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q27YU4_CHLRE
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain E； PDBConstruct 1–216； UniProt 1–216

Flagellar radial spoke protein 1

Chlamydomonas reinhardtii

UniProt Q27YU0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 15	Radial spoke protein 10 × 1 （Q27YU4） Nucleoside diphosphate kinase 6 × 1 （Q69B19） Flagellar radial spoke protein 2 × 1 （Q6UBQ3） unknown protein × 1 Flagellar radial spoke protein 3 × 1 （P12759） Flagellar radial spoke protein 5 × 1 （Q27YU7） Radial spoke protein 9 × 2 （Q27YU5） Flagellar radial spoke protein 4 × 1 （Q01656） Flagellar radial spoke protein 6 × 1 （Q01657） Flagellar radial spoke protein 6 × 1 Flagellar radial spoke protein 10 × 1 Flagellar radial spoke protein 1 × 1 Flagellar radial spoke protein 2 × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RSP1_CHLRE
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain F； PDBConstruct 1–814； UniProt 1–814

Nucleoside diphosphate kinase 6

Chlamydomonas reinhardtii

UniProt Q69B19

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 15	Radial spoke protein 10 × 1 （Q27YU4） Flagellar radial spoke protein 1 × 1 （Q27YU0） Flagellar radial spoke protein 2 × 1 （Q6UBQ3） unknown protein × 1 Flagellar radial spoke protein 3 × 1 （P12759） Flagellar radial spoke protein 5 × 1 （Q27YU7） Radial spoke protein 9 × 2 （Q27YU5） Flagellar radial spoke protein 4 × 1 （Q01656） Flagellar radial spoke protein 6 × 1 （Q01657） Flagellar radial spoke protein 6 × 1 Flagellar radial spoke protein 10 × 1 Flagellar radial spoke protein 1 × 1 Flagellar radial spoke protein 2 × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q69B19_CHLRE
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain K； PDBConstruct 1–586； UniProt 1–586

Flagellar radial spoke protein 2

Chlamydomonas reinhardtii

UniProt Q6UBQ3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 15	Radial spoke protein 10 × 1 （Q27YU4） Flagellar radial spoke protein 1 × 1 （Q27YU0） Nucleoside diphosphate kinase 6 × 1 （Q69B19） unknown protein × 1 Flagellar radial spoke protein 3 × 1 （P12759） Flagellar radial spoke protein 5 × 1 （Q27YU7） Radial spoke protein 9 × 2 （Q27YU5） Flagellar radial spoke protein 4 × 1 （Q01656） Flagellar radial spoke protein 6 × 1 （Q01657） Flagellar radial spoke protein 6 × 1 Flagellar radial spoke protein 10 × 1 Flagellar radial spoke protein 1 × 1 Flagellar radial spoke protein 2 × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RSP2_CHLRE
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain I； PDBConstruct 1–738； UniProt 1–738

Flagellar radial spoke protein 3

Chlamydomonas reinhardtii

UniProt P12759

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 15	Radial spoke protein 10 × 1 （Q27YU4） Flagellar radial spoke protein 1 × 1 （Q27YU0） Nucleoside diphosphate kinase 6 × 1 （Q69B19） Flagellar radial spoke protein 2 × 1 （Q6UBQ3） unknown protein × 1 Flagellar radial spoke protein 5 × 1 （Q27YU7） Radial spoke protein 9 × 2 （Q27YU5） Flagellar radial spoke protein 4 × 1 （Q01656） Flagellar radial spoke protein 6 × 1 （Q01657） Flagellar radial spoke protein 6 × 1 Flagellar radial spoke protein 10 × 1 Flagellar radial spoke protein 1 × 1 Flagellar radial spoke protein 2 × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RSP3_CHLRE
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain G； PDBConstruct 6–362； UniProt 160–516

Flagellar radial spoke protein 5

Chlamydomonas reinhardtii

UniProt Q27YU7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 15	Radial spoke protein 10 × 1 （Q27YU4） Flagellar radial spoke protein 1 × 1 （Q27YU0） Nucleoside diphosphate kinase 6 × 1 （Q69B19） Flagellar radial spoke protein 2 × 1 （Q6UBQ3） unknown protein × 1 Flagellar radial spoke protein 3 × 1 （P12759） Radial spoke protein 9 × 2 （Q27YU5） Flagellar radial spoke protein 4 × 1 （Q01656） Flagellar radial spoke protein 6 × 1 （Q01657） Flagellar radial spoke protein 6 × 1 Flagellar radial spoke protein 10 × 1 Flagellar radial spoke protein 1 × 1 Flagellar radial spoke protein 2 × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RSP5_CHLRE
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain H； PDBConstruct 1–527； UniProt 1–527

Radial spoke protein 9

Chlamydomonas reinhardtii

UniProt Q27YU5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 15	Radial spoke protein 10 × 1 （Q27YU4） Flagellar radial spoke protein 1 × 1 （Q27YU0） Nucleoside diphosphate kinase 6 × 1 （Q69B19） Flagellar radial spoke protein 2 × 1 （Q6UBQ3） unknown protein × 1 Flagellar radial spoke protein 3 × 1 （P12759） Flagellar radial spoke protein 5 × 1 （Q27YU7） Flagellar radial spoke protein 4 × 1 （Q01656） Flagellar radial spoke protein 6 × 1 （Q01657） Flagellar radial spoke protein 6 × 1 Flagellar radial spoke protein 10 × 1 Flagellar radial spoke protein 1 × 1 Flagellar radial spoke protein 2 × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q27YU5_CHLRE
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain A； PDBConstruct 1–269； UniProt 1–269 Author chain B； PDBConstruct 1–269； UniProt 1–269

Flagellar radial spoke protein 4

Chlamydomonas reinhardtii

UniProt Q01656

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 15	Radial spoke protein 10 × 1 （Q27YU4） Flagellar radial spoke protein 1 × 1 （Q27YU0） Nucleoside diphosphate kinase 6 × 1 （Q69B19） Flagellar radial spoke protein 2 × 1 （Q6UBQ3） unknown protein × 1 Flagellar radial spoke protein 3 × 1 （P12759） Flagellar radial spoke protein 5 × 1 （Q27YU7） Radial spoke protein 9 × 2 （Q27YU5） Flagellar radial spoke protein 6 × 1 （Q01657） Flagellar radial spoke protein 6 × 1 Flagellar radial spoke protein 10 × 1 Flagellar radial spoke protein 1 × 1 Flagellar radial spoke protein 2 × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RSP4_CHLRE
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain C； PDBConstruct 2–466； UniProt 1–465

Flagellar radial spoke protein 6

Chlamydomonas reinhardtii

UniProt Q01657

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 15	Radial spoke protein 10 × 1 （Q27YU4） Flagellar radial spoke protein 1 × 1 （Q27YU0） Nucleoside diphosphate kinase 6 × 1 （Q69B19） Flagellar radial spoke protein 2 × 1 （Q6UBQ3） unknown protein × 1 Flagellar radial spoke protein 3 × 1 （P12759） Flagellar radial spoke protein 5 × 1 （Q27YU7） Radial spoke protein 9 × 2 （Q27YU5） Flagellar radial spoke protein 4 × 1 （Q01656） Flagellar radial spoke protein 6 × 1 Flagellar radial spoke protein 10 × 1 Flagellar radial spoke protein 1 × 1 Flagellar radial spoke protein 2 × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RSP6_CHLRE
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain D； PDBConstruct 1–459； UniProt 1–459

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7jrj
Deposition date deposition_date	2020-08-12
Structure title title	Chlamydomonas reinhardtii radial spoke head and neck (recombinant)
Keywords keywords	Cilia, Radial spoke, Mechano-regulation, STRUCTURAL PROTEIN; STRUCTURAL PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7jrj__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7jrj__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7jrj__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	55.98 Å
Rg (electron density)	55.82 Å
Total Rg	55.45 Å
Atom count	22924
Residues	3059
Excluded volume	406390 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7jrj__assembly_1__model_1`	pentadecameric （15）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (14)

Entity 1 Entity 1 polymer

Description description	Radial spoke protein 10
Molecular weight formula_weight	23553.9 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E
Atom count atom_count	22924

MADDELPPQPVWEGPLDEDGKPHGLGKMEYPPPPMGEDDEEEKPGDKFEGTMEHGVRTGKGTYTWGVSGAVYTGDYVNGKKHGKGKMVYPDKGVYEGDWVEDVMQGQGTYTYPNGDIYQGAFWAGKRHGKGMYHYKGPCCQLVGDWADGGFTYGRWVYADGSMFMGKFGGAAADSKPTAGSYFYSSSSLVQEGHFAKDGSWVGHRDPAVGKEFSVA

Source Source

Source organism organism	Chlamydomonas reinhardtii
NCBI taxonomy ID ncbi_taxonomy_id	3055
Host organism host_organism	Spodoptera frugiperda

Entity 2 Entity 2 polymer

Description description	Flagellar radial spoke protein 1
Molecular weight formula_weight	87873.4 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

MALGPFVLPFRGDQYSFGINFKSSPEEKLNFDLSCVAFDVKGQLHDTLHARKPTALDGALVKGFEKQALPEETVQVEGDDVIYMFPKKFERQVEVLLFVASAPSIPGKKHDLDSSSKLEFAVSYSDVGGQAFNQSFDLKPLAAQGGVSSIIVAVMYLQAEGGWTLRSVGDCHPFDSPGLIVPELKQTILNLRDHHGVQLDAADAIQAIDPAERVPVTRQFQDQSLDEASAGRAAEPAPVKKLRIDLSWTFWPPPPPTEEGEEPPEEPALEYNLVMYNKDGEEVQSISTGNREATGARAGRPEPEEDEEEEKEEEKEEPEEGEEGEEGEGGEPKEPPPPPPAPKVDPYEFKERDVIYLDVPDLPAEVRSMVLLVTNYDEENGFTRVRTVRCRLVDVSNGEAPLPGSKAAVAAAAAAAEQGLAAPPNPERVLADYGVLSKYEDDKATTQVALMKLYKEYADSAFNVFRGAGVDNVAAFIGQEPDTIINQLKAYLEATKKQKAAEAAAAAAAEESGEEITADPKPHVWRFRALGLNFGGDSLEAIEHDLKNLFAFDGDLAPGAARDSDTSRSSFPNGDTYFGSYADDVKHGPGLYAFATGAGYAGEYAGGKRHGRGVMVFPDGGTYVGEFVADKFEGQGQYRYPDGSVYTGSWAAGQKHGPGVYWDTARGCLRGEWKKGLLVGKGTYEQPALRFEGEFVRGMPAGTATYTLTGHRTLDMPCFAAQHIQAEEGPTLALPCAYGIPPGSGDEPQLDEEGQPIEDTDKPPLPAHPKYEGLTFTAEQLPGAAPDTVFPPEEGKPVPITAVPAFSVSTGLVA

Source Source

Source organism organism	Chlamydomonas reinhardtii
NCBI taxonomy ID ncbi_taxonomy_id	3055
Host organism host_organism	Spodoptera frugiperda

Entity 3 Entity 3 polymer

Description description	Nucleoside diphosphate kinase 6
Molecular weight formula_weight	61422.2 kDa
EC 编号 ec_number	2.7.4.6
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K

MAELEKTFALIKPDAVRAGKAQEIMQLIELNGFTIIAKQKLQLTRARAEEFYGEHKGKEFFPKLVNFMTSGPIWALVLAKPGAILAWRALMGPTNVFKARAEQPKCLRALYGTDGTQNATHGSDSPISAAREIKFFFPTLSGDPTIYAEPTAAAEYITKRIQPALAKALAALAREKPSADKFEAITFVAGYLLQNNPNKPKVLMPDEWDPALMGDDEDDEADFINARLAAPTGNDGATKAEFDAMVEAAKADTGGAAPAQEFVYPDSKPTTPVVPAPPAPGSKPPSASGARPQSARPTSARPPSASAAPPAPLAPVPPPASSSRPASGSGRPPSATARPPSATPPPPPPAVELEEADDPAQLDEAATKVQAAFRGYQARKEVAVMRSEAQPGEAAAEPEQEAELQPEAEPEPQPEGEQEPQPQASASSSFLPDGVTEEMAAEAATRVQAHMRGHLARKQVAAIKAQQAAPAVAESSEALAEPEPQPEAEAEPQPQASVSSSFLPDGVTEEMAAEAATLVQAHMRGHLARKQVAAIKAQQAAPAVAESSEAQAEAEQTEAEAEPQPDAEAEAGAAEGEAEPEPEAAE

Source Source

Source organism organism	Chlamydomonas reinhardtii
NCBI taxonomy ID ncbi_taxonomy_id	3055
Host organism host_organism	Spodoptera frugiperda

Entity 4 Entity 4 polymer

Description description	Flagellar radial spoke protein 2
Molecular weight formula_weight	77445.3 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

MAPTQAGHDTAYLKETVGEALARGCAAAISAQPNDPVEYLGLWLLKYVKNAEVEGNFYRERQQDLQKKKDRLVKEAQSEQAAKSVALTRKEAADALALVTAEPRELLEAAVKLVKQHTAAGAAYAAVVAEPEEPDWVAPEDDEAAAVETEDEAAGGAALAEGEEPPPEPEPEPEAAPEDGEGDAPAPKIPRPVDYSKKYFAYVAASAGQEHVLEADLYRPAPPPEDADEDFKPEPLPYSFRVLDEKLPMLYVPNVAAEERVKFFRKFPKIGSYQACGVALPASGEFKALLAADTLFPEGSGQPLSADDRDFVWEVSQSLSRALEAVQARAAEALAATSAAEAVEELKAKVAELREQAAAEAAAAAPPPPAEGEEGEGEAPPAEEEPPAEEEAEEEEEEAEEGAEEGAEEGEEGEEAPPKPKKKKKVFNPIPGLQAAIEKLTAAAEAATEADARAQAAVALEKQALDEVVALASSHSDATLSSLRNMLSVPQGTYHVVKALLHLLGRPAASFSTWKRAHSHFSPRLFEDMAAYDATAERDMAVWGRVRSCYKAAPAAKKLDAEMPNTLFGSVALMYIKQVRRVARKAVLQRELAAKLAKAQQDLADKQAALVEAERVKAEREAEEARLAAEAEAAAAAEAEAAARAAAEAEAAAAAEAAAEAAAEAAAAAAEAAAEAGEGEAVAEREAAPAEAEAAPAEGEAAPPAEGEGEAQPAQEGSNSSSSSSDSSSSEESKAAAE

Source Source

Source organism organism	Chlamydomonas reinhardtii
NCBI taxonomy ID ncbi_taxonomy_id	3055
Host organism host_organism	Spodoptera frugiperda

Entity 5 Entity 5 polymer

Description description	unknown protein
Molecular weight formula_weight	358.4 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

XXXX

Source Source

Source organism organism	Chlamydomonas reinhardtii
NCBI taxonomy ID ncbi_taxonomy_id	3055
Host organism host_organism	Spodoptera frugiperda

Entity 6 Entity 6 polymer

Description description	Flagellar radial spoke protein 3
Molecular weight formula_weight	39361.3 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

GAAAEPILEVLVGKVLEQGLMEVLEEEELAAMRAHQEHFEQIRNAELVATQRMEAAERRKLEEKERRMQQERERVERERVVRQKVAASAFARGYLSGIVNTVFDRLVSSGYIYDPVMREVETAFMPWLKEQAIGYLARGVVARRVVDKLVEDAAAALAANRSTLADKAASTAATVDAWAERQAKMEAELQGKELEAVRRRPTFVLRELKPAVASADAVEAAAAELTAQAEEAANAKWEADKAEAAEKARAEAEAAAEEQKALLEELAATAAAEAEERGEEPPAEPPSLPDGVEPVDVEAEVAKAVEAVPKPPVKEVTDIDILSYMMDKGAITKDAIIQALAVHALGDKAYTNHPAFAEAEGA

Source Source

Source organism organism	Chlamydomonas reinhardtii
NCBI taxonomy ID ncbi_taxonomy_id	3055
Host organism host_organism	Spodoptera frugiperda

Entity 7 Entity 7 polymer

Description description	Flagellar radial spoke protein 5
Molecular weight formula_weight	55928.2 kDa
EC 编号 ec_number	1.-.-.-
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

MSEPGEEPVAAPAGPAPDPVLNELYGSERPAVELLPGVPLSPIVNSCWLPADAKAMLAESWIPVPPEDAGEEAGPPPPAFEAAAPEYNELVRRLAKTAPFRKWNELTIQAKQLEQEVAGLKGPDAEAKQAELENVKVQIADAEAAVAEVKQSFSDDPLSLTGWMQALTDLADGGMTTFEVSGQGWPYCSLRQLFGEMPSAAPPAGFFDGVERVLGTFKRRYEKERGPGSVQLMLKLAPNVFSDAWSTGGAPAAVAAVEAYVERARANVFGPDGGVTPEGVPEPLDLVQLVWWDFAAADPLPVLKALQRMATDQLQVDEDSGEVSVSEPKKIRGIGLVDFPADRLKAAIQAGVPITCVQVEHSVLVRSAQPVLDLCAKYGIKVLARGGTLGGLLSAKYLGAPPPDPVRGDADLDSVPGCLDAVNNVGGWARLQAALAVIKGIADKHGVKPETVALRWQIDAGCFPLVTTRWSSRVWRQFGYEGWSSFEVSGGRPGVDGPLFQVESFLDVEDVRALAGLAAVHLGPKAG

Source Source

Source organism organism	Chlamydomonas reinhardtii
NCBI taxonomy ID ncbi_taxonomy_id	3055
Host organism host_organism	Spodoptera frugiperda

Entity 8 Entity 8 polymer

Description description	Radial spoke protein 9
Molecular weight formula_weight	29572.3 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B

MVQLEPNITLVLKHLASCGAVVSAEQQAALDHSIPIKRIEAGLRSLTLWGRLTTLNGKDYLVAEGYNVASSKEGAAVYETKYFYSQDGARWSDLQPVDSETATRCARIKGMLSGDPAKNYELEEKDPNAPEPSPEAEEEVKPLVFQIPELAVLRCRVDAIATATSVIPTDSTILNAASQVVPNRLFAGAAYPEKLESYQHRFSLPGSGVTLSQDLRGTWAVQYDAFKGVAQVRSLLFPGYFFYYAANELTWGSLYVGDGLRNNDLIFML

Source Source

Source organism organism	Chlamydomonas reinhardtii
NCBI taxonomy ID ncbi_taxonomy_id	3055
Host organism host_organism	Spodoptera frugiperda

Entity 9 Entity 9 polymer

Description description	Flagellar radial spoke protein 4
Molecular weight formula_weight	49900.8 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

GMAAVDSVAQALAYLQVHSPQDGTSMYDHLVKLVSKVLEDQPKNAVDLLETSLLVKKSTFDPKESSPLVPIPVAPDATQTQAAVSIFGDPELPINPATGEPVPADPPNEFEAENMLGAAAVLDCLGVGLGRELGVNIALAAKRIGEDPKLAVRSVRFFGKFLGLYSDYFVFEVAFKKEAAKEAAPAAPAPERVEGEAASSSAPEVPVEEPGKGANKFTYLVCSSLGGPLTRLPDVTPAQVKASRRIKKLLTGRLTSHVSTYPAFPGNEANYLRALIARISAATVVAPSDLFSLNDETGELERAEDWEPPAGREMAAPTAWVHVRPHLKSQGRCEVHKRELPEDADEDEFYNEDELEEGPDLLAALEEDAQLPGEQAAWTPIYSSASEAVKTQAGGLRSLVWPGAVCGGRGSEWTCVYVGWGVKNAPFVPLPPPPVAQEFAWGEVETQELELKPAPPPPEEEAEADE

Source Source

Source organism organism	Chlamydomonas reinhardtii
NCBI taxonomy ID ncbi_taxonomy_id	3055
Host organism host_organism	Spodoptera frugiperda

Entity 10 Entity 10 polymer

Description description	Flagellar radial spoke protein 6
Molecular weight formula_weight	48884.6 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

MAADVGQALAFLQQVKTTQGASIYEGLKAALAKVLEDRPVNAVEALETSVLSTPPAANLSVPLVPAASAAAAAAAVAKASLFGDPEPVLDPESGEPIDPDAPNEFECEDVEGDGDLLDGLGVGLGRQEMYAAMLAVKRLGEDAKRGVSTVRFFGKFFGTQADYYVFETTLQSNPDMPEAPEGTIPLEPYGEGVNAYIYFVSNTLGGPLQQLPYVTPEQIKASRLLRRYLTGRLDAPVSAFPAFPGNEANYLRALIARISAATVCCPRGFFTADDDSAELSANDEWVPLKGREMALPVNWSHRYAHLKGQGRTVTHKRDPPDEEEEPEKNFWTAEEMEAGPPPLATLDTDAPLPAATGDKVPPPAWSPVFASASVTTRNQVAGVRSNRWPGAVCACAGRHFTSMYVGWGIKAGGEWSPCPPPPPVPQWGAPAAGVEGGQQLLLECNDLPPKPAPPEEEDE

Source Source

Source organism organism	Chlamydomonas reinhardtii
NCBI taxonomy ID ncbi_taxonomy_id	3055
Host organism host_organism	Spodoptera frugiperda

Entity 11 Entity 11 polymer

Description description	Flagellar radial spoke protein 6
Molecular weight formula_weight	528.6 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

XXXXXX

Source Source

Source organism organism	Chlamydomonas reinhardtii
NCBI taxonomy ID ncbi_taxonomy_id	3055
Host organism host_organism	Spodoptera frugiperda

Entity 12 Entity 12 polymer

Description description	Flagellar radial spoke protein 10
Molecular weight formula_weight	443.5 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M

XXXXX

Source Source

Source organism organism	Chlamydomonas reinhardtii
NCBI taxonomy ID ncbi_taxonomy_id	3055
Host organism host_organism	Spodoptera frugiperda

Entity 13 Entity 13 polymer

Description description	Flagellar radial spoke protein 1
Molecular weight formula_weight	7592.4 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	N

XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

Source Source

Source organism organism	Chlamydomonas reinhardtii
NCBI taxonomy ID ncbi_taxonomy_id	3055
Host organism host_organism	Spodoptera frugiperda

Entity 14 Entity 14 polymer

Description description	Flagellar radial spoke protein 2
Molecular weight formula_weight	5890.3 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	O

XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

Source Source

Source organism organism	Chlamydomonas reinhardtii
NCBI taxonomy ID ncbi_taxonomy_id	3055
Host organism host_organism	Spodoptera frugiperda

▼

6. Fold Classification (SCOP + CATH) 2 domains

SCOP 2.08 (1 domains)

Domain ID domain_id	d7jrjk_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.58 — Ferredoxin-like
Superfamily Superfamily superfamily	d.58.6 — Nucleoside diphosphate kinase, NDK
Family Family family	d.58.6.0 — automated matches

CATH v4.4 (1 domains)

Domain ID domain_id	7jrjK01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	141 — Nucleoside diphosphate kinase-like domain

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.03 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	136659

Chlamydomonas reinhardtii radial spoke head and neck (recombinant)

1. Protein Identity and Related Structures Protein Identity & Related Structures

Radial spoke protein 10

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Flagellar radial spoke protein 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Nucleoside diphosphate kinase 6

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Flagellar radial spoke protein 2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Flagellar radial spoke protein 3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Flagellar radial spoke protein 5

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Radial spoke protein 9

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Flagellar radial spoke protein 4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Flagellar radial spoke protein 6

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7jrj__assembly_1__model_1

7jrj__assembly_1__model_1 | I(q)

7jrj__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment