SAXSdb — 7jts

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Radial spoke protein 3

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 13	Dynein 8 kDa light chain, flagellar outer arm × 8 （Q39580） FAP207 × 1 （A0A2K3DJP7） FAP253 × 1 （A0A2K3D359） Calmodulin × 1 （A8IDP6）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A8J2J7_CHLRE
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain E； PDBConstruct 1–516； UniProt 1–516 Author chain F； PDBConstruct 1–516； UniProt 1–516

Dynein 8 kDa light chain, flagellar outer arm

OrganismNot specified

UniProt Q39580

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 13	Radial spoke protein 3 × 2 （A8J2J7） FAP207 × 1 （A0A2K3DJP7） FAP253 × 1 （A0A2K3D359） Calmodulin × 1 （A8IDP6）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	DYL1_CHLRE
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain a； PDBConstruct 1–91； UniProt 1–91 Author chain b； PDBConstruct 1–91； UniProt 1–91 Author chain c； PDBConstruct 1–91； UniProt 1–91 Author chain d； PDBConstruct 1–91； UniProt 1–91 Author chain e； PDBConstruct 1–91； UniProt 1–91 Author chain f； PDBConstruct 1–91； UniProt 1–91 Author chain g； PDBConstruct 1–91； UniProt 1–91 Author chain h； PDBConstruct 1–91； UniProt 1–91

FAP207

OrganismNot specified

UniProt A0A2K3DJP7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 13	Radial spoke protein 3 × 2 （A8J2J7） Dynein 8 kDa light chain, flagellar outer arm × 8 （Q39580） FAP253 × 1 （A0A2K3D359） Calmodulin × 1 （A8IDP6）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A2K3DJP7_CHLRE
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain m； PDBConstruct 1–256； UniProt 1–256

FAP253

OrganismNot specified

UniProt A0A2K3D359

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 13	Radial spoke protein 3 × 2 （A8J2J7） Dynein 8 kDa light chain, flagellar outer arm × 8 （Q39580） FAP207 × 1 （A0A2K3DJP7） Calmodulin × 1 （A8IDP6）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A2K3D359_CHLRE
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain s； PDBConstruct 1–682； UniProt 1–682

Calmodulin

OrganismNot specified

UniProt A8IDP6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 13	Radial spoke protein 3 × 2 （A8J2J7） Dynein 8 kDa light chain, flagellar outer arm × 8 （Q39580） FAP207 × 1 （A0A2K3DJP7） FAP253 × 1 （A0A2K3D359）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A8IDP6_CHLRE
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain t； PDBConstruct 1–163； UniProt 1–163

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7jts
Deposition date deposition_date	2020-08-18
Structure title title	Stalk of radial spoke 1 attached with doublet microtubule from Chlamydomonas reinhardtii
Keywords keywords	cilia, native, complex, microtubule, mechanoregulation, STRUCTURAL PROTEIN; STRUCTURAL PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7jts__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7jts__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7jts__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	50.92 Å
Rg (electron density)	51.55 Å
Total Rg	51.30 Å
Atom count	6801
Residues	1377
Excluded volume	109860 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7jts__assembly_1__model_1`	tridecameric （13）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	Radial spoke protein 3
Molecular weight formula_weight	56856.7 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,F
Atom count atom_count	6801

MVQAKAQQQLYTHAAEPKAVQQRRAKYREDETTQTLPTANIMFDRRVVRGNTYAARILPADATQTQTKGPSPASTKKRTTRTLPPRTPEAVDGRRHIDIQTDVYLEELTDTVPEADTSTQTDAFLDRPPTPLFVPQKTGTDAITQIENGDLFDFDFEVEPILEVLVGKVLEQGLMEVLEEEELAAMRAHQEHFEQIRNAELVATQRMEAAERRKLEEKERRMQQERERVERERVVRQKVAASAFARGYLSGIVNTVFDRLVSSGYIYDPVMREVETAFMPWLKEQAIGYLARGVVARRVVDKLVEDAAAALAANRSTLADKAASTAATVDAWAERQAKMEAELQGKELEAVRRRPTFVLRELKPAVASADAVEAAAAELTAQAEEAANAKWEADKAEAAEKARAEAEAAAEEQKALLEELAATAAAEAEERGEEPPAEPPSLPDGVEPVDVEAEVAKAVEAVPKPPVKEVTDIDILSYMMDKGAITKDAIIQALAVHALGDKAYTNHPAFAEAEGA

Entity 2 Entity 2 polymer

Description description	Dynein 8 kDa light chain, flagellar outer arm
Molecular weight formula_weight	10336.8 kDa
Source method src_method	nat
Copy count entity_count	8

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	a,b,c,d,e,f,g,h

MASGSSKAVIKNADMSEEMQADAVDCATQALEKYNIEKDIAAYIKKEFDRKHNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG

Entity 3 Entity 3 polymer

Description description	FAP207
Molecular weight formula_weight	28418.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	m

MPPNIPGTLTAESLRRKQGDQLWKTSDQKAQKEGPHHTVYWTTGERYQGSWKDNKKHGKGTVIYKNSDKYEGDWANDMRHGLGTLWLYRDGKYVVRYNGEWRADQPTGHGTFFADNGDTYEGEWLNGRRHGKGRAVYGGRPVDGFGGDVYEGYFENDVKCGPGTMMYANGDVYEGLWAADKKNGTGTYFYMSKGKRFDGVWADGAIKCGTYSEIHAPPPGTPGALPPCELRNPDKVLAEATMEASEAATEAAARGL

Entity 4 Entity 4 polymer

Description description	FAP253
Molecular weight formula_weight	75037.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	s

MSDPEAEQGEQGYEESPEEPGPGSEAPSPSRIDNGLDTIIDIDPQTQHAEEGSNTAYESEQPDVISSYTGGQQEEDGEQAGNGAIDETTEEAAGEADDGGKASGFAVEVDAGTDAAAEGDLEPEPEPERPASASGEPQPTASTSRPASGAAARPASARPTSARPGSAAPRQPSASGGSRPGSGHPVNLAPDSVGLAQQQQQKSQIEVGAQAYEARGSSRPQSGGDAYGQAEEASAAAAAGRPSTSQSGSRPPPSREGVAVVPSIPEDQPLAVPIHIERYIAPGLKAIEVEVAQGPGMPHRLVRVLLDYTQCDAKPYLGGFRNKRTGAVYHHGATQTPRAPKYSEADRKLSRETQTVKIKQHSQQTVREQATQMARPGVLLDNDYDKEVTPGRYQTADERDEIVLRSTLRIQRWVRGWLGRKRAAYLRGKKMEREAFLRDQEARAQSEAEEHRRREIQRRMHPRTAADFEVLYNELEAWRLQETRKIKEAGLAKEQEQQVLQQLLHKETKLLQTIDRLKINANQENKEARIQHTLNEMSKPKKFALRNGGKVDVHTPFTTRAKELQQLYNGLNLPLLTVDERLDVLLHVKWTVKEFDCDLTRELVDLIDREADLLNRGRNPKMLEGLRKRISSLFLNFIETPEFNPEAVRFQIVPMDFEAYLYEQVGKATAKAGTSVGTRTLS

Entity 5 Entity 5 polymer

Description description	Calmodulin
Molecular weight formula_weight	18317.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	t

MAANTEQLTEEQIAEFKEAFALFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMISEVDADGNGTIDFPEFLMLMARKMKETDHEDELREAFKVFDKDGNGFISAAELRHVMTNLGEKLSEEEVDEMIREADVDGDGQVNYEEFVRMMTSGATDDKDKKGHK

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	6.10 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	143514

Stalk of radial spoke 1 attached with doublet microtubule from Chlamydomonas reinhardtii

1. Protein Identity and Related Structures Protein Identity & Related Structures

Radial spoke protein 3

State in the Current Structure

Other States of the Same Protein in the Database

Dynein 8 kDa light chain, flagellar outer arm

State in the Current Structure

Other States of the Same Protein in the Database

FAP207

State in the Current Structure

Other States of the Same Protein in the Database

FAP253

State in the Current Structure

Other States of the Same Protein in the Database

Calmodulin

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7jts__assembly_1__model_1

7jts__assembly_1__model_1 | I(q)

7jts__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 polymer

Polymer Polymer

7. Citations (1)

Stalk of radial spoke 1 attached with doublet microtubule from Chlamydomonas reinhardtii

1. Protein Identity and Related Structures Protein Identity & Related Structures

Radial spoke protein 3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Dynein 8 kDa light chain, flagellar outer arm

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

FAP207

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

FAP253

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Calmodulin

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7jts__assembly_1__model_1

7jts__assembly_1__model_1 | I(q)

7jts__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 polymer

Polymer Polymer

7. Citations (1)