SAXSdb — 7m57

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Coat protein

OrganismNot specified

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Homooligomer Protein × 60 RNA 158 PDB declaration: 218-meric（218） Consistent with all polymer counts	Chain A； UniProt 1–159 Chain B； UniProt 1–159 Chain BB； UniProt 1–159 Chain C； UniProt 1–159 Chain CC； UniProt 1–159 Chain D； UniProt 1–159 Chain DD； UniProt 1–159 Chain E； UniProt 1–159 Chain EE； UniProt 1–159 Chain F； UniProt 1–159 Chain FF； UniProt 1–159 Chain G； UniProt 1–159 Chain GG； UniProt 1–159 Chain H； UniProt 1–159 Chain HH； UniProt 1–159 Chain I； UniProt 1–159 Chain II； UniProt 1–159 Chain J； UniProt 1–159 Chain JJ； UniProt 1–159 Chain K； UniProt 1–159 Chain KK； UniProt 1–159 Chain L； UniProt 1–159 Chain LL； UniProt 1–159 Chain M； UniProt 1–159 Chain MM； UniProt 1–159 Chain N； UniProt 1–159 Chain NN； UniProt 1–159 Chain O； UniProt 1–159 Chain OO； UniProt 1–159 Chain PP； UniProt 1–159	Not recorded	;RNA (5'-R(PAPAPAPAPAPAPAPAPAPAPAPAPAPAPAPA)-3') ; × 60 RNA (27-mer) × 98 PO4 PHOSPHATE ION × 12	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；pH 6；298 K；Crystals were grown by sitting drop vapor diffusion in Cryschem plates using 0.6 ml reservoirs. The drops were 6 to 8 ul and composed of equal volumes of a 5 mg/ml virus stock solution buffered with 0.1 M phosphate at pH 6.5, and the reservoir. The reservoirs were 16% ammonium sulfate buffered at pH 6.0 with 0.1 M phosphate. Crystallization was a room temperature.	Resolution 4.00 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 7M57	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1A34 SATELLITE TOBACCO MOSAIC VIRUS/RNA COMPLEX Deposited 1998-01-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Homooligomer；Protein × 60 PDB declaration: 180-MERIC	Chain A 1–159（159 aa）	Not recorded	SO4 SULFATE ION × 60 U5P URIDINE-5'-MONOPHOSPHATE × 60	X-RAY DIFFRACTION X-ray crystallization conditions liquid diffusion in microgravity；pH 6.5；PROTEIN WAS FOUR TIMES RECRYSTALLIZED FROM BULK SOLUTION BY ADDITION AF AMMONIUM SULFATE TO 15% SATURATION. SPACE CRYSTALS WERE GROWN BY LIQUID-LIQUID DIFFUSION IN A MICROGRAVITY ENVIRONMENT OVER 12 DAYS ABOARD IML-I MISSION OF THE US SPACE SHUTTLE., pH 6.50, liquid diffusion in microgravity	Resolution 1.81 Å R-free 0.184
1A34 SATELLITE TOBACCO MOSAIC VIRUS/RNA COMPLEX Deposited 1998-01-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein–RNA Monomer；Protein × 1 PDB declaration: trimeric	Chain A 1–159（159 aa）	Not recorded	SO4 SULFATE ION × 1 U5P URIDINE-5'-MONOPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions liquid diffusion in microgravity；pH 6.5；PROTEIN WAS FOUR TIMES RECRYSTALLIZED FROM BULK SOLUTION BY ADDITION AF AMMONIUM SULFATE TO 15% SATURATION. SPACE CRYSTALS WERE GROWN BY LIQUID-LIQUID DIFFUSION IN A MICROGRAVITY ENVIRONMENT OVER 12 DAYS ABOARD IML-I MISSION OF THE US SPACE SHUTTLE., pH 6.50, liquid diffusion in microgravity	Resolution 1.81 Å R-free 0.184
1A34 SATELLITE TOBACCO MOSAIC VIRUS/RNA COMPLEX Deposited 1998-01-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein–RNA Homooligomer；Protein × 5 PDB declaration: pentadecameric	Chain A 1–159（159 aa）	Not recorded	SO4 SULFATE ION × 5 U5P URIDINE-5'-MONOPHOSPHATE × 5	X-RAY DIFFRACTION X-ray crystallization conditions liquid diffusion in microgravity；pH 6.5；PROTEIN WAS FOUR TIMES RECRYSTALLIZED FROM BULK SOLUTION BY ADDITION AF AMMONIUM SULFATE TO 15% SATURATION. SPACE CRYSTALS WERE GROWN BY LIQUID-LIQUID DIFFUSION IN A MICROGRAVITY ENVIRONMENT OVER 12 DAYS ABOARD IML-I MISSION OF THE US SPACE SHUTTLE., pH 6.50, liquid diffusion in microgravity	Resolution 1.81 Å R-free 0.184
1A34 SATELLITE TOBACCO MOSAIC VIRUS/RNA COMPLEX Deposited 1998-01-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein–RNA Homooligomer；Protein × 6 PDB declaration: octadecameric	Chain A 1–159（159 aa）	Not recorded	SO4 SULFATE ION × 6 U5P URIDINE-5'-MONOPHOSPHATE × 6	X-RAY DIFFRACTION X-ray crystallization conditions liquid diffusion in microgravity；pH 6.5；PROTEIN WAS FOUR TIMES RECRYSTALLIZED FROM BULK SOLUTION BY ADDITION AF AMMONIUM SULFATE TO 15% SATURATION. SPACE CRYSTALS WERE GROWN BY LIQUID-LIQUID DIFFUSION IN A MICROGRAVITY ENVIRONMENT OVER 12 DAYS ABOARD IML-I MISSION OF THE US SPACE SHUTTLE., pH 6.50, liquid diffusion in microgravity	Resolution 1.81 Å R-free 0.184
1A34 SATELLITE TOBACCO MOSAIC VIRUS/RNA COMPLEX Deposited 1998-01-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 5 Protein–RNA Monomer；Protein × 1 PDB declaration: trimeric	Chain A 1–159（159 aa）	Not recorded	SO4 SULFATE ION × 1 U5P URIDINE-5'-MONOPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions liquid diffusion in microgravity；pH 6.5；PROTEIN WAS FOUR TIMES RECRYSTALLIZED FROM BULK SOLUTION BY ADDITION AF AMMONIUM SULFATE TO 15% SATURATION. SPACE CRYSTALS WERE GROWN BY LIQUID-LIQUID DIFFUSION IN A MICROGRAVITY ENVIRONMENT OVER 12 DAYS ABOARD IML-I MISSION OF THE US SPACE SHUTTLE., pH 6.50, liquid diffusion in microgravity	Resolution 1.81 Å R-free 0.184
1A34 SATELLITE TOBACCO MOSAIC VIRUS/RNA COMPLEX Deposited 1998-01-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 6 Protein–RNA Homooligomer；Protein × 15 PDB declaration: 45-meric	Chain A 1–159（159 aa）	Not recorded	SO4 SULFATE ION × 15 U5P URIDINE-5'-MONOPHOSPHATE × 15	X-RAY DIFFRACTION X-ray crystallization conditions liquid diffusion in microgravity；pH 6.5；PROTEIN WAS FOUR TIMES RECRYSTALLIZED FROM BULK SOLUTION BY ADDITION AF AMMONIUM SULFATE TO 15% SATURATION. SPACE CRYSTALS WERE GROWN BY LIQUID-LIQUID DIFFUSION IN A MICROGRAVITY ENVIRONMENT OVER 12 DAYS ABOARD IML-I MISSION OF THE US SPACE SHUTTLE., pH 6.50, liquid diffusion in microgravity	Resolution 1.81 Å R-free 0.184
4NIA Satellite Tobacco Mosaic Virus Refined at room temperature to 1.8 A Resolution using NCS Restraints Deposited 2013-11-05	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Homooligomer；Protein × 60 PDB declaration: 240-meric	Chain A 1–159（159 aa） Chain B 1–159（159 aa） Chain C 1–159（159 aa） Chain D 1–159（159 aa） Chain E 1–159（159 aa） Chain F 1–159（159 aa） Chain G 1–159（159 aa） Chain H 1–159（159 aa） Chain I 1–159（159 aa） Chain J 1–159（159 aa） Chain K 1–159（159 aa） Chain L 1–159（159 aa） Chain M 1–159（159 aa） Chain N 1–159（159 aa） Chain O 1–159（159 aa）	Not recorded	MG MAGNESIUM ION × 12 PO4 PHOSPHATE ION × 12 SO4 SULFATE ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions LIQUID DIFFUSION；pH 6.5；296 K；9 crystals were grown in microgravity aboard IML-I mission of the U.S. Space Shuttle over 12 days using 20% ammonium sulfate as precipitant, pH 6.50, LIQUID DIFFUSION, temperature 296K X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；296 K；12 crystals grown from 8% ammonium sulfate on earth with a reservoir of 14-16% ammonium sulfate, pH 6.50, VAPOR DIFFUSION, SITTING DROP, temperature 296K	Resolution 1.82 Å R-free 0.156
4OQ8 Satellite Tobacco Mosaic Virus Refined to 1.4 A Resolution using icosahedral constraints Deposited 2014-02-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Homooligomer；Protein × 60 PDB declaration: 240-meric	Chain A 1–159（159 aa）	Not recorded	PO4 PHOSPHATE ION × 60 SO4 SULFATE ION × 120 MG MAGNESIUM ION × 60	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；296 K；crystals grown from 15% ammonium sulfate on earth with a reservoir of 15% ammonium sulfate over 14 days., pH 6.50, VAPOR DIFFUSION, SITTING DROP, temperature 296K	Resolution 1.45 Å R-free 0.279
4OQ8 Satellite Tobacco Mosaic Virus Refined to 1.4 A Resolution using icosahedral constraints Deposited 2014-02-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein–RNA Monomer；Protein × 1 PDB declaration: tetrameric	Chain A 1–159（159 aa）	Not recorded	PO4 PHOSPHATE ION × 1 SO4 SULFATE ION × 2 MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；296 K；crystals grown from 15% ammonium sulfate on earth with a reservoir of 15% ammonium sulfate over 14 days., pH 6.50, VAPOR DIFFUSION, SITTING DROP, temperature 296K	Resolution 1.45 Å R-free 0.279
4OQ8 Satellite Tobacco Mosaic Virus Refined to 1.4 A Resolution using icosahedral constraints Deposited 2014-02-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein–RNA Homooligomer；Protein × 5 PDB declaration: eicosameric	Chain A 1–159（159 aa）	Not recorded	PO4 PHOSPHATE ION × 5 SO4 SULFATE ION × 10 MG MAGNESIUM ION × 5	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；296 K；crystals grown from 15% ammonium sulfate on earth with a reservoir of 15% ammonium sulfate over 14 days., pH 6.50, VAPOR DIFFUSION, SITTING DROP, temperature 296K	Resolution 1.45 Å R-free 0.279
4OQ8 Satellite Tobacco Mosaic Virus Refined to 1.4 A Resolution using icosahedral constraints Deposited 2014-02-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein–RNA Homooligomer；Protein × 6 PDB declaration: 24-meric	Chain A 1–159（159 aa）	Not recorded	PO4 PHOSPHATE ION × 6 SO4 SULFATE ION × 12 MG MAGNESIUM ION × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；296 K；crystals grown from 15% ammonium sulfate on earth with a reservoir of 15% ammonium sulfate over 14 days., pH 6.50, VAPOR DIFFUSION, SITTING DROP, temperature 296K	Resolution 1.45 Å R-free 0.279
4OQ8 Satellite Tobacco Mosaic Virus Refined to 1.4 A Resolution using icosahedral constraints Deposited 2014-02-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 5 Protein–RNA Monomer；Protein × 1 PDB declaration: tetrameric	Chain A 1–159（159 aa）	Not recorded	PO4 PHOSPHATE ION × 1 SO4 SULFATE ION × 2 MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；296 K；crystals grown from 15% ammonium sulfate on earth with a reservoir of 15% ammonium sulfate over 14 days., pH 6.50, VAPOR DIFFUSION, SITTING DROP, temperature 296K	Resolution 1.45 Å R-free 0.279
4OQ8 Satellite Tobacco Mosaic Virus Refined to 1.4 A Resolution using icosahedral constraints Deposited 2014-02-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 6 Protein–RNA Homooligomer；Protein × 15 PDB declaration: 60-meric	Chain A 1–159（159 aa）	Not recorded	PO4 PHOSPHATE ION × 15 SO4 SULFATE ION × 30 MG MAGNESIUM ION × 15	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；296 K；crystals grown from 15% ammonium sulfate on earth with a reservoir of 15% ammonium sulfate over 14 days., pH 6.50, VAPOR DIFFUSION, SITTING DROP, temperature 296K	Resolution 1.45 Å R-free 0.279
4OQ9 Satellite Tobacco Mosaic Virus Refined to 1.4 A Resolution using non-crystallographic symmetry restraints Deposited 2014-02-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Homooligomer；Protein × 60 PDB declaration: 240-meric	Chain A 1–159（159 aa） Chain B 1–159（159 aa） Chain C 1–159（159 aa） Chain D 1–159（159 aa） Chain E 1–159（159 aa） Chain F 1–159（159 aa） Chain G 1–159（159 aa） Chain H 1–159（159 aa） Chain I 1–159（159 aa） Chain J 1–159（159 aa） Chain K 1–159（159 aa） Chain L 1–159（159 aa） Chain M 1–159（159 aa） Chain N 1–159（159 aa） Chain O 1–159（159 aa）	Not recorded	PO4 PHOSPHATE ION × 12 SO4 SULFATE ION × 72 NA SODIUM ION × 68 MG MAGNESIUM ION × 12	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；296 K；crystals grown from 15% ammonium sulfate on earth with a reservoir of 15% ammonium sulfate over 14 days., pH 6.50, VAPOR DIFFUSION, SITTING DROP, temperature 296K	Resolution 1.45 Å R-free 0.250
4OQ9 Satellite Tobacco Mosaic Virus Refined to 1.4 A Resolution using non-crystallographic symmetry restraints Deposited 2014-02-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein–RNA Homooligomer；Protein × 15 PDB declaration: 60-meric	Chain A 1–159（159 aa） Chain B 1–159（159 aa） Chain C 1–159（159 aa） Chain D 1–159（159 aa） Chain E 1–159（159 aa） Chain F 1–159（159 aa） Chain G 1–159（159 aa） Chain H 1–159（159 aa） Chain I 1–159（159 aa） Chain J 1–159（159 aa） Chain K 1–159（159 aa） Chain L 1–159（159 aa） Chain M 1–159（159 aa） Chain N 1–159（159 aa） Chain O 1–159（159 aa）	Not recorded	PO4 PHOSPHATE ION × 3 SO4 SULFATE ION × 18 NA SODIUM ION × 17 MG MAGNESIUM ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；296 K；crystals grown from 15% ammonium sulfate on earth with a reservoir of 15% ammonium sulfate over 14 days., pH 6.50, VAPOR DIFFUSION, SITTING DROP, temperature 296K	Resolution 1.45 Å R-free 0.250
4OQ9 Satellite Tobacco Mosaic Virus Refined to 1.4 A Resolution using non-crystallographic symmetry restraints Deposited 2014-02-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein–RNA Homooligomer；Protein × 15 PDB declaration: 60-meric	Chain A 1–159（159 aa） Chain B 1–159（159 aa） Chain C 1–159（159 aa） Chain D 1–159（159 aa） Chain E 1–159（159 aa） Chain F 1–159（159 aa） Chain G 1–159（159 aa） Chain H 1–159（159 aa） Chain I 1–159（159 aa） Chain J 1–159（159 aa） Chain K 1–159（159 aa） Chain L 1–159（159 aa） Chain M 1–159（159 aa） Chain N 1–159（159 aa） Chain O 1–159（159 aa）	Not recorded	PO4 PHOSPHATE ION × 3 SO4 SULFATE ION × 18 NA SODIUM ION × 17 MG MAGNESIUM ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；296 K；crystals grown from 15% ammonium sulfate on earth with a reservoir of 15% ammonium sulfate over 14 days., pH 6.50, VAPOR DIFFUSION, SITTING DROP, temperature 296K	Resolution 1.45 Å R-free 0.250
4OQ9 Satellite Tobacco Mosaic Virus Refined to 1.4 A Resolution using non-crystallographic symmetry restraints Deposited 2014-02-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein–RNA Homooligomer；Protein × 15 PDB declaration: 60-meric	Chain A 1–159（159 aa） Chain B 1–159（159 aa） Chain C 1–159（159 aa） Chain D 1–159（159 aa） Chain E 1–159（159 aa） Chain F 1–159（159 aa） Chain G 1–159（159 aa） Chain H 1–159（159 aa） Chain I 1–159（159 aa） Chain J 1–159（159 aa） Chain K 1–159（159 aa） Chain L 1–159（159 aa） Chain M 1–159（159 aa） Chain N 1–159（159 aa） Chain O 1–159（159 aa）	Not recorded	PO4 PHOSPHATE ION × 3 SO4 SULFATE ION × 18 NA SODIUM ION × 17 MG MAGNESIUM ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；296 K；crystals grown from 15% ammonium sulfate on earth with a reservoir of 15% ammonium sulfate over 14 days., pH 6.50, VAPOR DIFFUSION, SITTING DROP, temperature 296K	Resolution 1.45 Å R-free 0.250
5BKL Crystallographic structure of the cubic crystal form of STMV (77.9 degree rotation) grown from NaCl Deposited 2021-03-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Homooligomer；Protein × 60 PDB declaration: 117-meric	Chain A 1–159（159 aa） Chain B 1–159（159 aa） Chain C 1–159（159 aa） Chain D 1–159（159 aa） Chain E 1–159（159 aa） Chain F 1–159（159 aa） Chain G 1–159（159 aa） Chain GG 1–159（159 aa） Chain H 1–159（159 aa） Chain HH 1–159（159 aa） Chain I 1–159（159 aa） Chain II 1–159（159 aa） Chain J 1–159（159 aa） Chain JJ 1–159（159 aa） Chain K 1–159（159 aa） Chain KK 1–159（159 aa） Chain L 1–159（159 aa） Chain M 1–159（159 aa） Chain N 1–159（159 aa） Chain O 1–159（159 aa）	Not recorded	CL CHLORIDE ION × 120 MG MAGNESIUM ION × 39	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6；279 K；Crystals were grown by sitting drop vapor diffusion in Cryschem plates using 0.6 ml reservoirs. The drops were composed of equal amounts of a 5 mg/ml stock virus solution buffered at pH6.5 with 0.1 M phosphate, and the reservoir solution which was 8% w/v NaCl buffered with 0.1 M phosphate at pH 6.0. Crystallization was carried out at 4 degrees C.	Resolution 2.94 Å R-free 0.256
5BKN Crystallographic structure of a cubic crystal form of STMV (84.5 degree rotation) grown from chloride Deposited 2021-03-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Homooligomer；Protein × 60 PDB declaration: 117-meric	Chain A 1–159（159 aa） Chain B 1–159（159 aa） Chain C 1–159（159 aa） Chain D 1–159（159 aa） Chain E 1–159（159 aa） Chain F 1–159（159 aa） Chain G 1–159（159 aa） Chain GG 1–159（159 aa） Chain H 1–159（159 aa） Chain HH 1–159（159 aa） Chain I 1–159（159 aa） Chain II 1–159（159 aa） Chain J 1–159（159 aa） Chain JJ 1–159（159 aa） Chain K 1–159（159 aa） Chain KK 1–159（159 aa） Chain L 1–159（159 aa） Chain M 1–159（159 aa） Chain N 1–159（159 aa） Chain O 1–159（159 aa）	Not recorded	CL CHLORIDE ION × 78 MG MAGNESIUM ION × 42	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6；279 K；Crystals were grown by sitting drop vapor diffusion in Cryschem plates using .6 ml reservoirs. The drops were composed of equal volumes of a 5 mg/ml virus stock solution of 0.1 M phosphate at pH 6.5, and the reservoir solution, which was 8% NaCl w/v in 0.1 M phosphate at pH 6.0. Crystallization was at 4 degrees C.	Resolution 3.00 Å R-free 0.255
5BKQ Crystallographic structure of a cubic form of STMV grown from nitrate Deposited 2021-03-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 60 PDB declaration: 60-meric	Chain A 1–159（159 aa） Chain B 1–159（159 aa） Chain C 1–159（159 aa） Chain D 1–159（159 aa） Chain E 1–159（159 aa） Chain F 1–159（159 aa） Chain G 1–159（159 aa） Chain GG 1–159（159 aa） Chain H 1–159（159 aa） Chain HH 1–159（159 aa） Chain I 1–159（159 aa） Chain II 1–159（159 aa） Chain J 1–159（159 aa） Chain JJ 1–159（159 aa） Chain K 1–159（159 aa） Chain KK 1–159（159 aa） Chain L 1–159（159 aa） Chain M 1–159（159 aa） Chain N 1–159（159 aa） Chain O 1–159（159 aa）	Not recorded	NO3 NITRATE ION × 306 MG MAGNESIUM ION × 27	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6；279 K；Crystals were grown by sitting drop vapor diffusion in Cryschem plates using 0.6 ml reservoirs. Drops were equal amounts of a 5 mg/ml virus stock solution buffered with 0.1 M phosphate at pH 6.5, and the reservoir solution which was 20% w/v sodium nitrate in 0.1 M phosphate at pH 6.0. Crystallization was carried out at 4 degrees C.	Resolution 3.19 Å R-free 0.273
7M2T Crystallographic Structure of the Monoclinic Form of Satellite Tobacco Mosaic Virus Deposited 2021-03-17	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Homooligomer；Protein × 60 PDB declaration: 218-meric	Chain A 1–159（159 aa） Chain B 1–159（159 aa） Chain BB 1–159（159 aa） Chain C 1–159（159 aa） Chain CC 1–159（159 aa） Chain D 1–159（159 aa） Chain DD 1–159（159 aa） Chain E 1–159（159 aa） Chain EE 1–159（159 aa） Chain F 1–159（159 aa） Chain FF 1–159（159 aa） Chain G 1–159（159 aa） Chain GG 1–159（159 aa） Chain H 1–159（159 aa） Chain HH 1–159（159 aa） Chain I 1–159（159 aa） Chain II 1–159（159 aa） Chain J 1–159（159 aa） Chain JJ 1–159（159 aa） Chain K 1–159（159 aa） Chain KK 1–159（159 aa） Chain L 1–159（159 aa） Chain LL 1–159（159 aa） Chain M 1–159（159 aa） Chain MM 1–159（159 aa） Chain N 1–159（159 aa） Chain NN 1–159（159 aa） Chain O 1–159（159 aa） Chain OO 1–159（159 aa） Chain PP 1–159（159 aa）	Not recorded	MG MAGNESIUM ION × 12 PO4 PHOSPHATE ION × 12 SO4 SULFATE ION × 10	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；279 K；Crystals grown by vapor diffusion as sitting drops. Drops were equal volumes of a 6 mg/ml STMV stock solution buffered at pH 6.5 with 0.1 M phosphate. The reservoirs were 16% saturated ammonium sulfate in 0.1 M phosphate at pH 6.5. Drops were 6 to 8 ul with 0.60 ml reservoirs. Crystals were grown at 4 degrees C over a weeks time.	Resolution 2.71 Å R-free 0.177
7M2V Crystallographic Structure of the Rhombohedral Crystal Form of STMV Grown from Chloride Deposited 2021-03-17	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Homooligomer；Protein × 60 PDB declaration: 120-meric	Chain A 1–159（159 aa） Chain B 1–159（159 aa） Chain C 1–159（159 aa） Chain D 1–159（159 aa） Chain E 1–159（159 aa） Chain FX 1–159（159 aa） Chain G 1–159（159 aa） Chain GG 1–159（159 aa） Chain H 1–159（159 aa） Chain HH 1–159（159 aa） Chain I 1–159（159 aa） Chain II 1–159（159 aa） Chain J 1–159（159 aa） Chain JJ 1–159（159 aa） Chain K 1–159（159 aa） Chain KK 1–159（159 aa） Chain L 1–159（159 aa） Chain M 1–159（159 aa） Chain NN 1–159（159 aa） Chain O 1–159（159 aa）	Not recorded	CL CHLORIDE ION × 39 MG MAGNESIUM ION × 24 PO4 PHOSPHATE ION × 12	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6；279 K；Crystals grown by sitting drop vapor diffusion in Cryschem plates with 0.6 ml reservoirs and 6 to 8 ul drops. Drops were equal amounts of a 5 mg/ml virus stock solution buffered at pH 6.5 with 0.1 M phosphate, and the reservoir solution. The reservoir solution was 4% w/v NaCl in 0.1 M phosphate at pH 6.0. Crystallization was at 4 degrees C.	Resolution 1.80 Å R-free 0.217
7M3R Crystallographic Structure of the Rhombohedral Crystal Form of STMV Grown from Bromide Deposited 2021-03-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 60 PDB declaration: 60-meric	Chain A 1–159（159 aa） Chain B 1–159（159 aa） Chain C 1–159（159 aa） Chain D 1–159（159 aa） Chain E 1–159（159 aa） Chain F 1–159（159 aa） Chain G 1–159（159 aa） Chain GG 1–159（159 aa） Chain H 1–159（159 aa） Chain HH 1–159（159 aa） Chain I 1–159（159 aa） Chain II 1–159（159 aa） Chain J 1–159（159 aa） Chain JJ 1–159（159 aa） Chain K 1–159（159 aa） Chain KK 1–159（159 aa） Chain L 1–159（159 aa） Chain M 1–159（159 aa） Chain N 1–159（159 aa） Chain O 1–159（159 aa）	Not recorded	BR BROMIDE ION × 573 MG MAGNESIUM ION × 24	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6；279 K；Crystals were grown by sitting drop vapor diffusion in Cryschem plates with 0.6 ml reservoirs and 6 to 8 ul drops. The drops were equal amounts of a 5 mg/ml virus stock solution buffered at pH 6.5 with 0.1 M phosphate. The reservoirs were 5% w/v NaBr in 0.1 M phosphate at pH 6.0. Crystallization was at 4 degrees C and the time of development was about 10 days.	Resolution 2.10 Å R-free 0.208
7M3T Crystallographic structure of a cubic crystal of STMV (80.7 degree rotation about 111) grown from chloride Deposited 2021-03-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Homooligomer；Protein × 60 PDB declaration: 117-meric	Chain A 1–159（159 aa） Chain B 1–159（159 aa） Chain C 1–159（159 aa） Chain D 1–159（159 aa） Chain E 1–159（159 aa） Chain F 1–159（159 aa） Chain G 1–159（159 aa） Chain GG 1–159（159 aa） Chain H 1–159（159 aa） Chain HH 1–159（159 aa） Chain I 1–159（159 aa） Chain II 1–159（159 aa） Chain J 1–159（159 aa） Chain JJ 1–159（159 aa） Chain K 1–159（159 aa） Chain KK 1–159（159 aa） Chain L 1–159（159 aa） Chain M 1–159（159 aa） Chain N 1–159（159 aa） Chain O 1–159（159 aa）	Not recorded	PO4 PHOSPHATE ION × 21 CL CHLORIDE ION × 42 MG MAGNESIUM ION × 18	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6；279 K；Crystals were grown by sitting drop vapor diffusion in Cryschem plates using 0.6 ml reservoirs. The drops were equal volumes of 5 mg/ml STMV in 0.1 M phosphate at pH 6.5 and the reservoir solution, which was 8% w/v NaCl in 0.1 M phosphate at pH 6.0. Crystallization was carried out at 4 degrees C.	Resolution 3.20 Å R-free 0.254
7M50 Crystallographic structure of a cubic crystal form of STMV grown from ammonium sulfate Deposited 2021-03-22	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Homooligomer；Protein × 60 PDB declaration: 117-meric	Chain A 1–159（159 aa） Chain B 1–159（159 aa） Chain C 1–159（159 aa） Chain D 1–159（159 aa） Chain E 1–159（159 aa） Chain F 1–159（159 aa） Chain G 1–159（159 aa） Chain GG 1–159（159 aa） Chain H 1–159（159 aa） Chain HH 1–159（159 aa） Chain I 1–159（159 aa） Chain II 1–159（159 aa） Chain J 1–159（159 aa） Chain JJ 1–159（159 aa） Chain K 1–159（159 aa） Chain KK 1–159（159 aa） Chain L 1–159（159 aa） Chain M 1–159（159 aa） Chain N 1–159（159 aa） Chain O 1–159（159 aa）	Not recorded	PO4 PHOSPHATE ION × 15 MG MAGNESIUM ION × 15 CL CHLORIDE ION × 3 SO4 SULFATE ION × 18	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6；279 K；Crystals were grown by sitting drop vapor diffusion in Cryschem plates using 0.6 ml reservoirs. Drops were 6 to 8 ul and were composed of equal volumes of a 5 mg/ml virus stock solution containing 0.1 M phosphate at pH 6.5, and the reservoir solution. The reservoir solution was 18% ammonium sulfate in 0.1 M phosphate at pH 6.0. Crystallization was carried out at 4 degrees C.	Resolution 2.31 Å R-free 0.271
7M54 Crystallographic structure of a cubic crystal form of STMV grown from bromide Deposited 2021-03-22	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 60 PDB declaration: 60-meric	Chain A 1–159（159 aa） Chain B 1–159（159 aa） Chain C 1–159（159 aa） Chain D 1–159（159 aa） Chain E 1–159（159 aa） Chain F 1–159（159 aa） Chain G 1–159（159 aa） Chain GG 1–159（159 aa） Chain H 1–159（159 aa） Chain HH 1–159（159 aa） Chain I 1–159（159 aa） Chain II 1–159（159 aa） Chain J 1–159（159 aa） Chain JJ 1–159（159 aa） Chain K 1–159（159 aa） Chain KK 1–159（159 aa） Chain L 1–159（159 aa） Chain M 1–159（159 aa） Chain N 1–159（159 aa） Chain O 1–159（159 aa）	Not recorded	CA CALCIUM ION × 18 BR BROMIDE ION × 546 MG MAGNESIUM ION × 27 CL CHLORIDE ION × 9	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6；279 K；crystals were grown by sitting drop vapor diffusion in Cryschem plates using 0.6 ml reservoirs. Drops were 6 to 8 ul and composed of equal volumes of a 5 mg/ml virus stock solution buffered at pH 6.5 with 0.1M phosphate, and the reservoir solution. The reservoir solution was 18% w/v NaBr buffered with 0.1 M phosphate at pH 6.0. Crystallization was carried out at 4 degrees C.	Resolution 3.80 Å R-free 0.285

13 other PDB entries and 26 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	COAT_STMV
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–159； UniProt 1–159 Author chain B； PDBConstruct 1–159； UniProt 1–159 Author chain BB； PDBConstruct 1–159； UniProt 1–159 Author chain C； PDBConstruct 1–159； UniProt 1–159 Author chain CC； PDBConstruct 1–159； UniProt 1–159 Author chain D； PDBConstruct 1–159； UniProt 1–159 Author chain DD； PDBConstruct 1–159； UniProt 1–159 Author chain E； PDBConstruct 1–159； UniProt 1–159 Author chain EE； PDBConstruct 1–159； UniProt 1–159 Author chain F； PDBConstruct 1–159； UniProt 1–159 Author chain FF； PDBConstruct 1–159； UniProt 1–159 Author chain G； PDBConstruct 1–159； UniProt 1–159 Author chain GG； PDBConstruct 1–159； UniProt 1–159 Author chain H； PDBConstruct 1–159； UniProt 1–159 Author chain HH； PDBConstruct 1–159； UniProt 1–159 Author chain I； PDBConstruct 1–159； UniProt 1–159 Author chain II； PDBConstruct 1–159； UniProt 1–159 Author chain J； PDBConstruct 1–159； UniProt 1–159 Author chain JJ； PDBConstruct 1–159； UniProt 1–159 Author chain K； PDBConstruct 1–159； UniProt 1–159 Author chain KK； PDBConstruct 1–159； UniProt 1–159 Author chain L； PDBConstruct 1–159； UniProt 1–159 Author chain LL； PDBConstruct 1–159； UniProt 1–159 Author chain M； PDBConstruct 1–159； UniProt 1–159 Author chain MM； PDBConstruct 1–159； UniProt 1–159 Author chain N； PDBConstruct 1–159； UniProt 1–159 Author chain NN； PDBConstruct 1–159； UniProt 1–159 Author chain O； PDBConstruct 1–159； UniProt 1–159 Author chain OO； PDBConstruct 1–159； UniProt 1–159 Author chain PP； PDBConstruct 1–159； UniProt 1–159

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7m57
Deposition date deposition_date	2021-03-22
Structure title title	Crystallographic structure of a primitive orthorhombic crystal form of STMV
Keywords keywords	VIRUS/RNA, VIRUS-RNA complex; VIRUS/RNA
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	63.25 Å
Radius of gyration Rg (electron density) rg_electron	64.43 Å
Forward intensity I(0) i0	6237530000.00
Molecular weight molecular_weight	581700.0 kDa
Excluded volume excluded_volume	692610 Å³
Envelope volume envelope_volume	1321200 Å³
Hydration-shell volume shell_volume	166050 Å³
Envelope diameter envelope_diameter	182.9 Å
Shell Rg shell_rg	73.74 Å
Envelope Rg envelope_rg	60.30 Å
Shape Rg shape_rg	64.52 Å
Total Rg total_rg	64.32 Å
Total atoms total_atoms	40402
Residues n_residues	4654
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	173.9 Å
Rg (real space) rg_real	62.81 Å
Rg uncertainty (real space) rg_real_error	0.84 Å
I(0) (real space) i0_real	6.2380e+09
I(0) uncertainty (real space) i0_real_error	1.1000e+08
Rg (reciprocal space) rg_reciprocal	63.57 Å
I(0) (reciprocal space) i0_reciprocal	6245000000.0000
Solution quality estimate total_estimate	0.8464
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	1
Primary peak position r_peak_primary	90.5 Å
Skewness Skewness skewness	-0.009
Kurtosis Kurtosis kurtosis	-0.777
Angular range angular_range	— – 0.1250 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	416800000.0000
Real-space data points n_real_points	26
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 1.000; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.999; Smooth: 0.000

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	Coat protein
Molecular weight formula_weight	17533.9 kDa
Source method src_method	nat
Copy count entity_count	30

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,BB,CC,DD,EE,FF,GG,HH,II,JJ,KK,LL,MM,NN,OO,PP
Atom count atom_count	49953

MGRGKVKPNRKSTGDNSNVVTMIRAGSYPKVNPTPTWVRAIPFEVSVQSGIAFKVPVGSLFSANFRTDSFTSVTVMSVRAWTQLTPPVNEYSFVRLKPLFKTGDSTEEFEGRASNINTRASVGYRIPTNLRQNTVAADNVCEVRSNCRQVALVISCCFN

Entity 2 Entity 2 polymer

Description description	;RNA (5'-R(PAPAPAPAPAPAPAPAPAPAPAPAPAPAPAPA)-3') ;
Molecular weight formula_weight	5222.3 kDa
Source method src_method	nat
Copy count entity_count	30

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	P,Q,R,S,T,U,V,W,X,Y,Z,a,b,c,d,QQ,RR,SS,TT,UU,VV,WW,YY,ZZ,bb,cc,dd,ee,ff,gg

AAAAAAAAAAAAAAAA

Entity 3 Entity 3 polymer

Description description	RNA (27-mer)
Molecular weight formula_weight	8221.5 kDa
Source method src_method	nat
Copy count entity_count	49

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	e,f,g,h,i,j,k,l,m,n,o,p,q,r,s,t,u,v,w,x,y,z,1,2,3,4,5,6,7,8,hh,ii,jj,kk,ll,mm,nn,oo,pp,qq,rr,ss,tt,uu,vv,ww,xx,yy,zz

UUUUUUUUUUUUUUUUUUUUUUUUUUU

Entity 4 Entity 4 non-polymer

Description description	PHOSPHATE ION
Molecular weight formula_weight	95.0 kDa
Source method src_method	syn
Copy count entity_count	6

Entity 5 Entity 5 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	16

▶

8. Citations (1)

▶

Unit-cell length a length_a	192.080 Å
Unit-cell length b length_b	202.290 Å
Unit-cell length c length_c	177.930 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	196

Space group space_group	P 21 21 2
Space-group number int_tables_number	18
Crystal system crystal_system	orthorhombic

Resolution resolution	4.000 Å
Low-resolution limit resolution_low	60.000 Å
R factor r_factor	—
R_work r_work	0.2000
R_free r_free	—

fit	/app/data/saxs_computation/m5/7m57/7m57.fit
pddf	/app/data/pr_computation/m5/7m57/7m57.pr.out
profile	/app/data/saxs_computation/m5/7m57/7m57.dat

Crystallographic structure of a primitive orthorhombic crystal form of STMV

1. Protein Identity and Related Structures Protein Identity & Related Structures

Coat protein

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

6. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 water

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)