SAXSdb — 7m6u

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Carboxypeptidase G2 circular permuation pro-domain fusion

synthetic construct

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein homooligomer	Homooligomer	Protein 2	ZINC ION × 11 SULFATE ION × 1 water × 2	Consistent with protein count
2	Protein homooligomer	Homooligomer	Protein 2	ZINC ION × 9 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CBPG_PSES6
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 24–350； UniProt 89–415 Author chain A； PDBConstruct 355–418； UniProt 25–88 Author chain B； PDBConstruct 24–350； UniProt 89–415 Author chain B； PDBConstruct 355–418； UniProt 25–88 Author chain C； PDBConstruct 24–350； UniProt 89–415 Author chain C； PDBConstruct 355–418； UniProt 25–88 Author chain D； PDBConstruct 24–350； UniProt 89–415 Author chain D； PDBConstruct 355–418； UniProt 25–88

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7m6u
Deposition date deposition_date	2021-03-26
Structure title title	Crystal structure of a circular permutation and computationally designed pro-enzyme of carboxypeptidase G2
Keywords keywords	pro-enzyme, enzyme design, directed enzyme-prodrug therapy, methotrexate, circular permutation, HYDROLASE; HYDROLASE
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7m6u__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7m6u__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7m6u__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	40.37 Å
Rg (electron density)	40.90 Å
Total Rg	40.89 Å
Atom count	5642
Residues	780
Excluded volume	99805 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7m6u__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`7m6u__assembly_2__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	Carboxypeptidase G2 circular permuation pro-domain fusion
Molecular weight formula_weight	47217.3 kDa
EC 编号 ec_number	3.4.17.11
Mutation mutation	K177A
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D
Atom count atom_count	11105

MGSSHHHHHHSSGLVPRGSHMGSLVVGDNIVGKIKGRGGKNLLLMSHMDTVYLKGILAKAPFRVEGDKAYGPGIADDKGGNAVILHTLKLLKEYGVRDYGTITVLFNTDEEAGSFGSRDLIQEEAKLADYVLSFEPTSAGDEKLSLGTSGIAYVQVNITGKASHAGAAPELGVNALVEASDLVLRTMNIDDKAKNLRFNWTIAKAGNVSNIIPASATLNADVRYARNEDFDAAMKTLEERAQQKKLPEADVKVIVTRGRPAFNAGEGGKKLVDKAVAYYKEAGGTLGVEERTGGGTDAAYAALSGKPVIESLGLPGFGYHSDKAEYVDISAIPRRLYMAARLIMDLGAGKGTASAQKRDNVLFQAATDEQPAVIKTLEKLVNIETGTGDAEGIAAAGNFLEAELKNLGFTVTRSKSAGGSPLGMWSRGSAEAAWKEAEAKDWAAKA

Source Source

Source organism organism	synthetic construct
NCBI taxonomy ID ncbi_taxonomy_id	32630
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 2 Entity 2 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	20

Entity 3 Entity 3 non-polymer

Description description	SULFATE ION
Molecular weight formula_weight	96.1 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	132

▶

Unit-cell length a length_a	78.540 Å
Unit-cell length b length_b	106.360 Å
Unit-cell length c length_c	121.930 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	107.48 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	—

Resolution resolution	2.590 Å
Low-resolution limit resolution_low	39.270 Å
R factor r_factor	0.2245
R_work r_work	0.2217
R_free r_free	0.2792

Crystal structure of a circular permutation and computationally designed pro-enzyme of carboxypeptidase G2

1. Protein Identity and Related Structures Protein Identity & Related Structures

Carboxypeptidase G2 circular permuation pro-domain fusion

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7m6u__assembly_1__model_1

7m6u__assembly_1__model_1 | I(q)

7m6u__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

7. Citations (2)

Crystal structure of a circular permutation and computationally designed pro-enzyme of carboxypeptidase G2

1. Protein Identity and Related Structures Protein Identity & Related Structures

Carboxypeptidase G2 circular permuation pro-domain fusion

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7m6u__assembly_1__model_1

7m6u__assembly_1__model_1 | I(q)

7m6u__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

7. Citations (2)