SAXSdb — 7m7j

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

EryAI

Saccharopolyspora erythraea

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 6	1B2 (heavy chain) × 2 1B2 (light chain) × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q5UNP6_SACER
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 32–1490； UniProt 557–2015 Author chain A； PDBConstruct 1491–1573； UniProt 3463–3545 Author chain B； PDBConstruct 32–1490； UniProt 557–2015 Author chain B； PDBConstruct 1491–1573； UniProt 3463–3545

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7m7j
Deposition date deposition_date	2021-03-28
Structure title title	6-Deoxyerythronolide B synthase (DEBS) module 1 in complex with antibody fragment 1B2: "turnstile closed" state (TE-free)
Keywords keywords	polyketide synthase, antibody fragment, BIOSYNTHETIC PROTEIN-IMMUNE SYSTEM complex; BIOSYNTHETIC PROTEIN/IMMUNE SYSTEM
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7m7j__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7m7j__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7m7j__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	48.41 Å
Rg (electron density)	48.08 Å
Total Rg	48.27 Å
Atom count	23224
Residues	3124
Excluded volume	409310 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7m7j__assembly_1__model_1`	hexameric （6）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	EryAI
Molecular weight formula_weight	167736.7 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,A
Atom count atom_count	23224

MASTDSEKVAEYLRRATLDLRAARQRIRELEGEPVAVVAMACRLPGGVSTPEEFWELLSEGRDAVAGLPTDRGWDLDSLFHPDPTRSGTAHQRGGGFLTEATAFDPAFFGMSPREALAVDPQQRLMLELSWEVLERAGIPPTSLQASPTGVFVGLIPQEYGPRLAEGGEGVEGYLMTGTTTSVASGRIAYTLGLEGPAISVDTACSSSLVAVHLACQSLRRGESSLAMAGGVTVMPTPGMLVDFSRMNSLAPDGRCKAFSAGANGFGMAEGAGMLLLERLSDARRNGHPVLAVLRGTAVNSDGASNGLSAPNGRAQVRVIQQALAESGLGPADIDAVEAHGTGTRLGDPIEARALFEAYGRDREQPLHLGSVKSNLGHTQAAAGVAGVIKMVLAMRAGTLPRTLHASERSKEIDWSSGAISLLDEPEPWPAGARPRRAGVSSFGISGTNAHAIIEEAPQVVEGERVEAGDVVAPWVLSASSAEGLRAQAARLAAHLREHPGQDPRDIAYSLATGRAALPHRAAFAPVDESAALRVLDGLATGNADGAAVGTSRAQQRAVFVFPGQGWQWAGMAVDLLDTSPVFAAALRECADALEPHLDFEVIPFLRAEAARREQDAALSTERVDVVQPVMFAVMVSLASMWRAHGVEPAAVIGHSQGEIAAACVAGALSLDDAARVVALRSRVIATMPGNKGMASIAAPAGEVRARIGDRVEIAAVNGPRSVVVAGDSDELDRLVASCTTECIRAKRLAVDYASHSSHVETIRDALHAELGEDFHPLPGFVPFFSTVTGRWTQPDELDAGYWYRNLRRTVRFADAVRALAEQGYRTFLEVSAHPILTAAIEEIGDGSGADLSAIHSLRRGDGSLADFGEALSRAFAAGVAVDWESVHLGTGARRVPLPTYPFQRERVWLEPKPVARRSTEVDEVSALRYRIEWRPTGAGEPARLDGTWLVAKYAGTADETSTAAREALESAGARVRELVVDARCGRDELAERLRSVGEVAGVLSLLAVDEAEPEEAPLALASLADTLSLVQAMVSAELGCPLWTVTESAVATGPFERVRNAAHGALWGVGRVIALENPAVWGGLVDVPAGSVAELARHLAAVVSGGAGEDQLALRADGVYGRRWVRAAAPATDDEWKPTGTVLVTGGTGGVGGQIARWLARRGAPHLLLVSRSGPDADGAGELVAELEALGARTTVAACDVTDRESVRELLGGIGDDVPLSAVFHAAATLDDGTVDTLTGERIERASRAKVLGARNLHELTRELDLTAFVLFSSFASAFGAPGLGGYAPGNAYLDGLAQQRRSDGLPATAVAWGTWAGSGMAEGPVADRFRRHGVIEMPPETACRALQNALDRAEVCPIVIDVRWDRFLLAYTAQRPTRLFDEIDDARRAAPQAAAEPRVGALASLPAPEREKALFELVRSHAAAVLGHASAERVPADQAFAELGVDSLSALELRNRLGAATGVRLPTTTVFDHPDVRTLAAHLAAELGTEVRGEAPSALAGLDALEAALPEVPATEREELVQRLERMLAALRPVAQAADASGTGANPSGDDLGEAGVDELLEALGRELDGDPNSSSVDKLAAALEHHHHHH

Source Source

Source organism organism	Saccharopolyspora erythraea
Common name common_name	Streptomyces erythraeus
NCBI taxonomy ID ncbi_taxonomy_id	1836
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 2 Entity 2 polymer

Description description	1B2 (heavy chain)
Molecular weight formula_weight	26447.6 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,E

MAEVQLVQSGGGLVQPGRSLRLSCTASGFTFGDYAMSWVRQAPGKGLEWVGFIRSKAYGGTTEYAASVKGRFTISRDDSKSIAYLQMNSLKTEDTAVYYCTRGGTLFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCAALVPRGSAHHHHHHAADYKDDDDKA

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 3 Entity 3 polymer

Description description	1B2 (light chain)
Molecular weight formula_weight	25715.8 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,F

LFAIPLVVPFYSHSALDVVMTQSPLSLPVTPGEPASISCRSSQSLLHSNGYNYLDWYLQKPGQSPQLLIYLGSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQSLQTPRLTFGPGTKVDIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPRGAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli BL21(DE3)

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	4.30 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	102772

6-Deoxyerythronolide B synthase (DEBS) module 1 in complex with antibody fragment 1B2: "turnstile closed" state (TE-free)

1. Protein Identity and Related Structures Protein Identity & Related Structures

EryAI

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7m7j__assembly_1__model_1

7m7j__assembly_1__model_1 | I(q)

7m7j__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

7. Citations (1)

6-Deoxyerythronolide B synthase (DEBS) module 1 in complex with antibody fragment 1B2: "turnstile closed" state (TE-free)

1. Protein Identity and Related Structures Protein Identity & Related Structures

EryAI

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7m7j__assembly_1__model_1

7m7j__assembly_1__model_1 | I(q)

7m7j__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

7. Citations (1)